KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_2562
Entry
A79E_2562         CDS       T02213                                 
Name
(GenBank) Xanthine permease
  KO
K16345  xanthine permease XanP
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
Brite
KEGG Orthology (KO) [BR:kpp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpp02000]
    A79E_2562
Transporters [BR:kpp02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   A79E_2562
SSDB
Motif
Pfam: Xan_ur_permease DUF7060
Other DBs
NCBI-ProteinID: AFQ65863
LinkDB
Position
complement(2720610..2721989)
AA seq 459 aa
MSDEHHSGLLYGLEQRIPPLPAFFSALQHVLAGLVGIITPPLIIGATLGLGDWLPYLISM
SLLASGIGTFLQSNRVWGIGAGMICMQGTSFAFLGVTVAGGMWVKAQGGGPQDMMAMLFG
VNFVAALVPVIVSRFIEPLKKIFTPIITGSVIALIGISLIKVSVINWCGGEKAEDFASMS
NIALGAGTLGVIVLLSCAKNRWLRLSSVVVGIAVGCIAAGLSGQFHLHSLGDTLFRLPTL
FPFGFQFNSAIFLPVALVSLVCILEAVGDLTANSLISQQSVDDRAFRNRLKGGILADGVS
CMVAAMLCAFPNTTFAQNNGVIQMTGVASRYVGRYIGVILILLGLFPPVGELLRQIPAPV
LGGATMVMFGCVVAAGIRIITQTPLSRRDVLIVGLAFGAGLGVESVPAFLSHFPPMVGDL
FGSAATSGGLVAIALNLILPQEQAATKSLRSQDDRAESV
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgtctgacgaacatcacagtggcctgctttacggccttgaacagcggatcccaccgctt
ccggcctttttcagcgctctccagcatgtgctggcgggcctggtggggatcatcacgccg
ccgctgatcatcggcgctaccctcgggcttggcgactggctgccgtatctcatcagtatg
tcgctgctggcctcgggcattggcacttttctgcagtccaatcgggtatggggcatcggc
gccgggatgatctgcatgcagggcaccagttttgccttcctcggcgtgacggtggccgga
gggatgtgggtaaaagcgcagggcggcgggccgcaggatatgatggcgatgctgtttggc
gttaactttgtcgccgctctggtgccggtgattgtcagccgctttatcgaaccgctgaag
aaaatctttactcccatcattaccggcagcgtgattgcgctgatcggcatcagcctgatc
aaggtcagcgtcatcaactggtgcggtggggaaaaggcagaggatttcgccagcatgagc
aacatcgcgctcggggcgggcaccctcggggttatcgtcctgctgagctgcgccaaaaac
cgctggctgcggctctcctcggtggtggtgggcattgccgtgggctgcatcgcagcgggg
ctgagcggtcagttccatctccacagcctgggcgacactctgtttcgcctgccgacgctg
tttccgttcggctttcagtttaacagcgcgatatttctgccggtcgccctggtgtcgctg
gtctgtattctggaggcggtgggcgatctgacggccaactcgctgatttcacaacagtct
gttgacgatcgcgctttccgtaaccggctgaagggcggtatcctggcggatggcgtcagc
tgtatggtggcggccatgctctgtgcttttccgaacaccaccttcgcgcagaacaacggc
gtgatccagatgaccggggtggccagccgctatgtcggacgctacattggcgtgattctg
atcctgctcgggctgttccccccggtgggcgaactgctgcggcagatcccggcgccggtg
ctggggggcgccacgatggtgatgtttggctgcgtggtggcggccgggatccggattatt
acccagaccccgctgagccgtcgcgatgtgctgatcgtggggctggcgtttggcgcgggt
cttggcgtggagtcggtgccggcgtttctcagccattttccgccgatggtcggcgatctg
ttcggttcggcggccaccagcggtgggctggtagcgatagcgctgaaccttattctgccg
caggagcaggcggcgacgaaatcgttaaggagtcaggatgatcgcgctgagtcagtttaa

DBGET integrated database retrieval system