Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_4712
Help
Entry
A79E_4712 CDS
T02213
Name
(GenBank) Acetate permease ActP
KO
K14393
cation/acetate symporter
Organism
kpp
Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
Brite
KEGG Orthology (KO) [BR:
kpp00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
kpp02000
]
A79E_4712
Transporters [BR:
kpp02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
A79E_4712
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SSF
DUF2818
Rv1476
Motif
Other DBs
NCBI-ProteinID:
AFQ63403
LinkDB
All DBs
Position
5000746..5002401
Genome browser
AA seq
551 aa
AA seq
DB search
MIKRVLTALAATLLPLGAHAADAITGAVQRQPTNWQAIVMFLIFVALTLYITYWASKRVR
SRSDYYTAGGNITGFQNGLAIAGDFMSAASFLGISALVYTSGYDGLIYSLGFLVGWPIIL
FLIAERLRNLGRYTFADVASYRLKQGPIRTLSACGSLVVVALYLIAQMVGAGKLIQLLFG
LNYHVAVVLVGVLMVLYVLFGGMLATTWVQIIKAVLLLCGASFMAFMVMKHVGFSFNNLF
TEAMAVHPKGAAIMSPGGLVKDPISALSLGLGLMFGTAGLPHILMRFFTVSDAKEARKSV
FYATGFMGYFYILTFIIGFGAIMLVGANPAFKDAAGQLIGGNNMAAVHLADAVGGNLFLG
FISAVAFATILAVVAGLTLAGASAVSHDLYANVFRKGATERQELKVSKITVLILGVVAIL
LGILFENQNIAFMVGLAFSIAASCNFPIILLSMYWSKLTTRGAMVGGWLGLLTAVILMIL
GPTIWVQILGHEKALFPYEYPALFSIAIAFIGIWVFSATDNSPEGMREREQFRAQFIRSQ
TGIGIERGQAH
NT seq
1656 nt
NT seq
+upstream
nt +downstream
nt
atgatcaagagagtcctgacggcgctcgccgccacgctgctgcccctcggcgctcacgcc
gcagacgctattaccggcgcggtacagcgccagccgaccaactggcaggcgattgtcatg
ttcctgattttcgttgccctgacgctgtacatcacctactgggcctcaaaacgggtgcgt
tcgcgcagcgattactacaccgccggcggcaatattaccggcttccagaacgggctggcg
attgccggcgactttatgtcagcggcgtcgttcctcggtatctccgcgctggtgtatacc
tccggctacgatgggctgatctactcgctgggctttctcgtcggctggccgattatcctg
tttctaattgctgaacgtctgcgcaatcttggccgctatacttttgccgatgtcgcctct
taccgcctgaagcaggggccgatccgcaccctctccgcctgcggttcgctggtggtggtg
gccctgtatctgattgcccagatggtgggcgccggcaagctgatccagctgctgttcggc
cttaattaccatgtcgccgtagtgctggttggcgtgctgatggtgctctatgtcctgttc
ggcggcatgctggcgaccacctgggtgcagattattaaagcggttctgctgctgtgcggc
gccagttttatggcctttatggtcatgaagcacgtcggcttcagcttcaataacctgttt
accgaggcgatggcggtccacccgaaaggggcggcgattatgagtcccggcggactggtg
aaagatccgatatccgcgctctctctgggtctgggtctgatgttcggtaccgctggcctg
ccgcatattctgatgcgcttctttaccgtgagcgacgccaaagaagcacgtaaaagcgtc
ttctacgccaccggttttatgggctatttctatatcctgacctttatcatcggcttcggc
gccatcatgctggtcggcgcgaacccggcgtttaaagacgcggccggacagcttatcggc
ggcaataacatggcggcggtgcacctggcggatgcggttggcggcaacctgttcctcggg
tttatctctgcggtagccttcgccactatcctggcggtggtggcgggcctgaccctcgcc
ggcgcgtcagcggtgtcgcacgacctgtacgccaacgtcttccgcaagggcgcgaccgag
cgtcaggagctgaaggtctccaagatcaccgtactgatccttggggtggtggccattctg
ctgggtattctgtttgaaaatcagaacattgctttcatggtcggcctggccttctccatc
gccgccagctgtaacttcccgattattctgctgtcgatgtactggtcgaagctgaccacc
cgcggcgcgatggtcggcggctggctgggcctgctgactgcggtcattctgatgatcctc
ggtcctaccatttgggtgcagatcctcggccatgagaaagcgctgttcccgtatgaatat
ccggcgctgttctccattgccatcgcgttcattggcatctgggtcttctccgccaccgat
aactcaccggaagggatgcgcgagcgcgagcagttccgcgcccagtttatccgttcacaa
accgggatcggtatcgaacgcggccaggcgcattaa
DBGET
integrated database retrieval system