KEGG   Klebsiella pneumoniae subsp. pneumoniae KPR0928: KPR0928_05320
Entry
KPR0928_05320     CDS       T03371                                 
Name
(GenBank) transcriptional regulator PhoB
  KO
K07657  two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
kpq  Klebsiella pneumoniae subsp. pneumoniae KPR0928
Pathway
kpq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KPR0928_05320
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:kpq02022]
    KPR0928_05320
Two-component system [BR:kpq02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   KPR0928_05320
SSDB
Motif
Pfam: Response_reg Trans_reg_C Response_reg_2
Other DBs
NCBI-ProteinID: AIE27079
LinkDB
Position
1118088..1118777
AA seq 229 aa
MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGS
GLQFIKLLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVM
RRISPMAVEEVIEMQGLSLDPSSHRVMTGDSPLDMGPTEFKLLHFFMTHPERVYSREQLL
NHVWGTNVYVEDRTVDVHIRRLRKALEHSGHDRMVQTVRGTGYRFSARF
NT seq 690 nt   +upstreamnt  +downstreamnt
atggcgagaagaattctggtcgttgaagatgaagctccaatccgcgaaatggtctgcttt
gttctggagcaaaatggctttcagcctgtcgaagcggaagattatgacagcgcggtgaat
caactcaatgaaccctggcctgatttgattctcctggactggatgctgccgggcggttcg
gggctgcagtttattaaactgctcaagcgcgaggcgatgacgcgggatattccggtagtg
atgctgaccgcgcgtggagaagaagaggatcgcgttcgcggcctggagaccggcgcggat
gactacatcaccaagcctttctctccgaaagagctggtggcgcgaatcaaagcggtgatg
cgccgtatttcaccgatggcggtggaagaggtgatcgaaatgcaggggctgagcctcgac
ccttcatcgcaccgggtaatgaccggcgacagtccgctggatatgggaccgacggaattt
aaattattgcacttctttatgacccatccggagcgggtgtacagccgcgaacagctgctg
aaccacgtctgggggaccaacgtttatgtggaagaccgcacggtggacgtccatattcgc
cgcctgcgcaaagcgctggaacacagtggccatgatcgtatggtgcaaacggttcgcggc
acggggtatcgtttctccgcccgtttctga

DBGET integrated database retrieval system