KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_4437
Entry
KPR_4437          CDS       T02793                                 
Name
(GenBank) unnamed protein product; similar to phosphonate ABC transporter, ATPase subunit from Serratia odorifera (tr|D1RNC8)
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
kpr02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:kpr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    KPR_4437
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpr02000]
    KPR_4437
Enzymes [BR:kpr01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     KPR_4437
Transporters [BR:kpr02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    KPR_4437
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_29 AAA_30 KdpD AAA_16 MMR_HSR1 Cellulase AAA_22 MeaB nSTAND1
Other DBs
NCBI-ProteinID: CCI78665
LinkDB
Position
4561498..4562340
AA seq 280 aa
MNSSLAAVAETDFQPFTDLAAGRQRKVLSVRNLSKAYQAQHKVLDGISFDLHAGEMVGVI
GRSGAGKSTLLHVLNGTHSASGGEILSYPEVGTPHDVSQLKGRALNAWRSHCGMIFQDFC
LVPRLDVLTNVLLGRLSQTSTLKSLFKIFPAADRARAIALLEWMNMLPHALQRAENLSGG
QMQRVAICRALMQNPGILLADEPVASLDPKNTQRIMDVLREISEQGISVMVNLHSVELVR
AYCTRVIGVASGQLIFDDHPSRLTQDVLQRLYGDEVSQLH
NT seq 843 nt   +upstreamnt  +downstreamnt
atgaacagctctcttgccgcggtggccgaaactgatttccagccgttcaccgatctcgct
gccggccggcagcggaaggtcttaagcgtgcgtaatctgagtaaagcttatcaagcccag
cacaaagtgctggacggcatcagctttgatctgcacgccggggaaatggtcggggtcatt
ggccgctccggcgccggtaaatcgacgctcctgcatgtcctcaacggcacccacagcgcc
agcggcggagaaattcttagctacccggaagtcggtaccccgcacgatgtctcacagctg
aaaggccgcgcgctcaatgcctggcgtagccactgcggaatgatttttcaggacttctgc
ctggtgccgcgcctcgacgtgctcaccaacgtcctgctgggccgcctcagccagacttca
accctgaaatcgctgtttaaaatctttcccgcagctgaccgggcgcgcgccattgcgctg
cttgagtggatgaacatgctgccgcacgcgctgcagcgggcggagaacctctccggcggg
cagatgcagcgggtggcgatctgccgggcgctgatgcaaaaccccgggatcctgctggcc
gacgagcctgtcgcctcgctggatccgaaaaacactcagcgcatcatggatgtgctgcgc
gagattagcgagcagggcatcagcgtgatggtaaacctgcattcggtggagctggtcagg
gcctactgcacccgggttatcggcgtcgccagcggccagcttatttttgacgatcacccc
tcccggctgacgcaggatgtgctgcagcggctgtacggcgatgaagttagccaattgcat
taa

DBGET integrated database retrieval system