Klebsiella pneumoniae 30684/NJST258_2: KPNJ2_00106 Help Entry KPNJ2_00106       CDS       T03177                                  Name (GenBank) Transcriptional regulator   KO K09892   cell division protein ZapB Organism kps  Klebsiella pneumoniae 30684/NJST258_2 Brite KEGG Orthology (KO) [BR:kps00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:kps03036]     KPNJ2_00106 Chromosome and associated proteins [BR:kps03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     KPNJ2_00106 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Nuf2_DHR10-like Syntaxin CtIP_N DUF3450 PspA_IM30 Leu_zip UPF0242 dCache_2 YabA Herpes_UL6 CCDC113_CCDC96_CC betaPIX_CC APG6_N ADIP DUF7801 Cep57_CLD_2 COG6_N DUF4763 Seryl_tRNA_N KASH_CCD DUF4757 CENP-H bZIP_2 DctP DUF4407 ERM_helical Cnn_1N ATG14 Tox-ODYAM1 Motif Other DBs NCBI-ProteinID:  AHM76886 UniProt:  W8VCQ9 LinkDB All DBs Position 105188..105433 Genome browser AA seq 81 aa AA seqDB search MTMSLEVFEKLESKVQQAIDTITLLQMEIEELKEKNNTLVQEVQSAQHGREELERENSQL KEQQQGWQERLQALLGRMEEV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacgatgtcattagaagtgtttgagaaattagaatctaaggttcagcaggcgattgat accatcactctgttgcagatggaaatcgaagagctgaaagaaaagaacaacaccctggtg caggaagttcagagcgcgcagcatggtcgtgaagagctggagcgcgaaaacagccagctg aaagagcagcagcagggctggcaggaacgtctgcaggcgctgctgggtcgcatggaagaa gtctaa

DBGET integrated database retrieval system