KEGG   Klebsiella pneumoniae 30684/NJST258_2: KPNJ2_04338
Entry
KPNJ2_04338       CDS       T03177                                 
Name
(GenBank) Alpha-ketoglutarate-dependent taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
kps  Klebsiella pneumoniae 30684/NJST258_2
Pathway
kps00430  Taurine and hypotaurine metabolism
kps00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:kps00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    KPNJ2_04338
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    KPNJ2_04338
Enzymes [BR:kps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     KPNJ2_04338
SSDB
Motif
Pfam: TauD ArsA_ATPase
Other DBs
NCBI-ProteinID: AHM81118
UniProt: W8UZP9
LinkDB
Position
complement(4192747..4193598)
AA seq 283 aa
MSERLSITPLGPYIGAQVSGADLTRPLSDNQFEQLYHAVLRHQVVFLREQNITPAQQRDL
ALRFGDLHIHPVYPHAPGVEEIIVLDTHNDNPPDNDNWHTDVTFIDTPPAGAILAAKELP
MTGGDTLWTSGIAAWEALSEPFRQLLSGLHAEHDFRKSFQEYKYNKTEAEHRRWQEAVAK
HPPLLHPVVRTHPVTGKQALFVNEGFTTRIVEVSEKESAALLNFLFAHVTKPEFQVRWRW
QPNDVAIWDNRVTQHYANADYLPQRRIMHRATILGDKPYYRAG
NT seq 852 nt   +upstreamnt  +downstreamnt
atgagtgaacgtctgagcattaccccgctggggccgtatattggcgcgcaggtgagcggg
gcggatttaacccgtccgctgagcgacaaccagtttgaacagctgtatcacgcggtgctg
cgtcatcaggtggtattcctgcgcgagcagaatatcaccccggcgcaacagcgcgacctg
gcgctgcggtttggcgacctgcatatccatccggtctaccctcatgccccaggtgtggag
gagattatcgtcctcgatacccacaacgataatccgccggataatgacaactggcatacc
gatgtcacctttatcgacacgccgcccgccggcgccattctggcggcgaaagagctgccg
atgaccggcggggacaccctgtggaccagcggcatcgccgcctgggaagcgctgtcagaa
cctttccggcagctgctgagcggcctgcatgccgaacacgatttccgcaaatcgttccag
gagtataagtacaacaagaccgaagccgagcatcggcgctggcaggaagcggtggcgaag
catccgccgctgctgcatccggtagtacgtacccacccggtgaccggcaagcaggcgctg
ttcgttaatgaaggctttaccacgcgaattgtcgaggtgagtgagaaagagagcgcagcg
ctgctgaacttcctgtttgctcatgtcactaaaccggagtttcaggtgcgctggcgctgg
cagccgaacgatgtcgctatctgggataaccgggtgacccagcattacgccaacgccgac
tatctgccgcagcggcggatcatgcaccgggcgacgatcctcggcgataagccgtattac
cgggcggggtaa

DBGET integrated database retrieval system