Kosakonia pseudosacchari: IP581_08780 Help Entry IP581_08780       CDS       T06897                                  Symbol dinI Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism kpse  Kosakonia pseudosacchari Brite KEGG Orthology (KO) [BR:kpse00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:kpse03400]     IP581_08780 (dinI) DNA repair and recombination proteins [BR:kpse03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     IP581_08780 (dinI) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI DUF2397 KH_PARP14_2 Motif Other DBs NCBI-ProteinID:  QOV65717 LinkDB All DBs Position complement(1885005..1885250) Genome browser AA seq 81 aa AA seqDB search MRIEVTIAKTTPLPPGAVDALAGELSRRLNNCYPDRENKITVRYAAANNLSVLGGAKEDK DRITEILQETWESADDWFITD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgcattgaagtgactatcgccaaaaccacacccttaccgcctggcgctgttgatgcg ctggcgggcgagttatctcgtcgtctgaacaattgttaccccgatcgcgaaaacaaaatt acggttcgctacgccgcagcaaataatctttcggttttgggcggcgcaaaagaagataaa gatcgcataactgaaattttgcaggaaacctgggaaagcgccgacgactggtttatcacc gactaa

DBGET integrated database retrieval system