Kosakonia pseudosacchari: IP581_20010 Help Entry IP581_20010       CDS       T06897                                  Name (GenBank) DinI family protein   KO K12149   DNA-damage-inducible protein I Organism kpse  Kosakonia pseudosacchari Brite KEGG Orthology (KO) [BR:kpse00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:kpse03400]     IP581_20010 DNA repair and recombination proteins [BR:kpse03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     IP581_20010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Rnk_N DUF1376 HTH_25 DUF6305 Motif Other DBs NCBI-ProteinID:  QOV63501 LinkDB All DBs Position complement(4233744..4233977) Genome browser AA seq 77 aa AA seqDB search MRIEIMIDKEQKISQSTLDALEAEIYRNLSPIYSKTAIRIRQASANGLQLSGVRLDEDKK RVMEILQQVWEDYNWLH NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgcgcattgaaataatgatcgataaagaacaaaaaatcagccagtccactcttgacgcg ctggaggctgaaatttaccggaatctgtcgccgatttactcgaaaaccgcaatccggatc agacaggcatcggccaatggcctgcaactgagcggcgttcggctcgatgaagataaaaaa cgggtaatggaaatactgcaacaggtctgggaggactataactggctacattaa

DBGET integrated database retrieval system