Kroppenstedtia pulmonis: GXN76_01450 Help Entry GXN76_01450       CDS       T06617                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kpul  Kroppenstedtia pulmonis Pathway kpul00998   Biosynthesis of various antibiotics kpul01100   Metabolic pathways kpul01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kpul00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GXN76_01450    00074 Mycolic acid biosynthesis     GXN76_01450   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GXN76_01450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 SBDS_C Ins_allergen_rp Motif Other DBs NCBI-ProteinID:  QKG83257 UniProt:  A0A7D4CUH4 LinkDB All DBs Position 289583..289831 Genome browser AA seq 82 aa AA seqDB search MNKSKLRDQLKEIIAEVIEVDEFGDEENFVSDLGVDSMMALEIVARIEQTFQIKIPEEYL PEVKSLNDVHRVVLEVMEHVRN NT seq 249 nt NT seq  +upstreamnt  +downstreamnt gtgaataaatcgaaattgagagatcaactgaaagagatcattgctgaagtgattgaggtg gatgagtttggtgatgaagaaaactttgttagtgatcttggggtagattctatgatggcc ttggaaattgtagcacggattgaacaaacctttcagattaaaatacctgaagaatacctg ccggaagttaaatctctcaatgatgtccatcgggttgttctggaggtaatggaacatgta cggaactag

DBGET integrated database retrieval system