Kitasatospora purpeofusca: ACFCLZ_05790 Help Entry ACFCLZ_05790      CDS       T11279                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism kpur  Kitasatospora purpeofusca Pathway kpur00253   Tetracycline biosynthesis kpur01056   Biosynthesis of type II polyketide backbone kpur01100   Metabolic pathways kpur01110   Biosynthesis of secondary metabolites Module kpur_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:kpur00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     ACFCLZ_05790    00253 Tetracycline biosynthesis     ACFCLZ_05790  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:kpur01004]     ACFCLZ_05790    01008 Polyketide biosynthesis proteins [BR:kpur01008]     ACFCLZ_05790 Lipid biosynthesis proteins [BR:kpur01004]  Polyketide synthase   Component type    ACFCLZ_05790 Polyketide biosynthesis proteins [BR:kpur01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      ACFCLZ_05790     Nonaketide PKS      ACFCLZ_05790     Decaketide PKS      ACFCLZ_05790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  XHR65175 LinkDB All DBs Position complement(1497920..1498177) Genome browser AA seq 85 aa AA seqDB search MSRLTFDDLRGILAECAGEDEQTRIDPEALDLPFTDLGYDSLALLETAAVITRRYGTDLA DDVVATVETPRQLLDLVNSAMAEAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagccgcctgaccttcgacgacctgcgcggcatcctcgccgagtgcgcgggcgaggac gagcagacccggatcgaccccgaggccctggatctgccgttcaccgacctcggctacgac tcgctggccctgctggagacggccgcggtgatcacccgccgctacggcaccgacctcgcg gacgacgtggtggcgaccgtggagaccccgcgtcagctgctcgacctggtgaacagcgcg atggccgaagcggcctga

DBGET integrated database retrieval system