Kitasatospora purpeofusca: ACFCLZ_12810 Help Entry ACFCLZ_12810      CDS       T11279                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kpur  Kitasatospora purpeofusca Pathway kpur00998   Biosynthesis of various antibiotics kpur01100   Metabolic pathways kpur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kpur00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACFCLZ_12810    00074 Mycolic acid biosynthesis     ACFCLZ_12810   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACFCLZ_12810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  XHR66489 LinkDB All DBs Position 3070779..3071021 Genome browser AA seq 80 aa AA seqDB search MATKDEVLEGLAEIVNEIAGIPAEDVELDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPD DEVKNLKTVGDAVDYILSHA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggctaccaaggacgaggttctggaaggtctcgccgagatcgtcaacgagatcgccggc atcccggccgaggacgtcgagctcgacaagtccttcaccgacgacctggacgtcgactcg ctgtccatggtcgaggtcgtcgtggccgccgaggagcgcttcgacgtcaagatcccggac gacgaggtcaagaacctgaagaccgtcggcgacgccgtggactacatcctcagccacgcc tga

DBGET integrated database retrieval system