Kitasatospora purpeofusca: ACFCLZ_16410
Help
Entry
ACFCLZ_16410 CDS
T11279
Name
(GenBank) pyridoxal phosphate-dependent aminotransferase
KO
K14260
alanine-synthesizing transaminase [EC:
2.6.1.66
2.6.1.2
]
Organism
kpur Kitasatospora purpeofusca
Pathway
kpur00220
Arginine biosynthesis
kpur00250
Alanine, aspartate and glutamate metabolism
kpur00290
Valine, leucine and isoleucine biosynthesis
kpur01100
Metabolic pathways
kpur01110
Biosynthesis of secondary metabolites
kpur01210
2-Oxocarboxylic acid metabolism
kpur01230
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:
kpur00001
]
09100 Metabolism
09105 Amino acid metabolism
00250 Alanine, aspartate and glutamate metabolism
ACFCLZ_16410
00290 Valine, leucine and isoleucine biosynthesis
ACFCLZ_16410
00220 Arginine biosynthesis
ACFCLZ_16410
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
kpur01007
]
ACFCLZ_16410
Enzymes [BR:
kpur01000
]
2. Transferases
2.6 Transferring nitrogenous groups
2.6.1 Transaminases
2.6.1.2 alanine transaminase
ACFCLZ_16410
2.6.1.66 valine---pyruvate transaminase
ACFCLZ_16410
Amino acid related enzymes [BR:
kpur01007
]
Aminotransferase (transaminase)
Class I
ACFCLZ_16410
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_1_2
DegT_DnrJ_EryC1
Aminotran_5
Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID:
XHR67139
LinkDB
All DBs
Position
3903949..3905163
Genome browser
AA seq
404 aa
AA seq
DB search
MQVIQSSKLANVCYDIRGPVLDEAMRLEEQGHRILKLNTGNPALFGFDAPPEILQDILRN
LSTAHGYGDSKGLLSARRAVVMHYEERGLESLTVDDVFLGNGVSELIQLAMTALLDDGDE
VLVPAPDYPLWTASVSLAGGTAVHYRCDEQSEWYPDLADIEAKVTDRTRALVVINPNNPT
GAVYPREVLEGLAGIARRHRLVIYADEIYDKILYDDAEHVPLASLAPDLFCVTFNGLSKS
YRVAGFRSGWMVLSGDRSRARSYVEGLNVLASMRLCANMPAQHAVAAALGGRQSIKDLVL
PGGRLLESRDAAYRLLNEIPGVSCVKPKGALYAFPRLDPKVFKIKDDARMVLDLLRAERI
LLVQGTGFNWPEPDHFRLVTLPRAEDITDAVTRIGLFLSGYTQP
NT seq
1215 nt
NT seq
+upstream
nt +downstream
nt
atgcaggtcatccagtccagcaagctcgccaatgtctgctacgacatccgcggtccggtg
ctcgacgaggcgatgcggctggaggaacagggccaccgcatcctgaagctcaacaccggc
aatcccgcgctgttcggcttcgacgcgccgcccgagatcctccaggacatcctgcgcaac
ctctccaccgcgcacggctacggcgactccaagggcctgctctccgcgcgccgcgccgtg
gtgatgcactacgaggagcgcggcctggagagcctgacggtcgacgacgtcttcctcggc
aacggcgtctccgaactgatccagctggcgatgaccgccctgctggacgacggcgacgag
gtgctcgtcccggccccggactacccgctgtggaccgcctccgtctcgctggccggcggc
accgccgtccactaccgctgcgacgagcagtccgagtggtacccggacctcgccgacatc
gaggccaaggtcaccgaccggaccagggcgctggtggtcatcaaccccaacaacccgacc
ggcgcggtctatccgcgcgaggtgctggaggggctggccgggatcgcccggcgccaccgg
ctggtgatctacgcggacgagatctacgacaagatcctctacgacgacgccgagcacgtc
ccgctggccagcctggcgcccgacctgttctgcgtcaccttcaacggcctgtccaagtcc
taccgggtggcgggcttccgctccggctggatggtgctctccggcgaccgctcccgggcc
cgcagctacgtcgagggcctgaacgtgctcgcctcgatgcggctgtgcgccaacatgccg
gcccagcacgcggtggccgcggcgctcggcggacgccagtcgatcaaggacctggtcctg
cccgggggccggctgctggagtcccgggacgcggcgtaccggctgctcaacgagatcccc
ggggtcagctgcgtgaagcccaagggcgcgctgtacgccttcccccggctggacccgaag
gtcttcaagatcaaggacgacgcccggatggtgctcgacctgctgcgggccgagcggatc
ctgctggtccagggcaccggcttcaactggcccgagccggaccacttccggctggtcacc
ctgccgcgcgcggaggacatcaccgacgcggtcacccggatcggcctgttcctgagcggc
tacacccagccctga
DBGET
integrated database retrieval system