Klebsiella pneumoniae PMK1: PMK1_03431 Help Entry PMK1_03431        CDS       T03419                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism kpx  Klebsiella pneumoniae PMK1 Pathway kpx01100   Metabolic pathways kpx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kpx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PMK1_03431 (acpP)    00074 Mycolic acid biosynthesis     PMK1_03431 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PMK1_03431 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AIT02873 UniProt:  W9BNY0 LinkDB All DBs Position 3719517..3719753 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgagcagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system