Klebsiella pneumoniae subsp. pneumoniae KPNIH31: KPNIH31_09015
Help
Entry
KPNIH31_09015 CDS
T03467
Name
(GenBank) lipid transporter ATP-binding/permease
KO
K11085
ATP-binding cassette, subfamily B, bacterial MsbA [EC:
7.5.2.6
]
Organism
kpy
Klebsiella pneumoniae subsp. pneumoniae KPNIH31
Pathway
kpy02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
kpy00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
KPNIH31_09015
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
kpy02000
]
KPNIH31_09015
Enzymes [BR:
kpy01000
]
7. Translocases
7.5 Catalysing the translocation of carbohydrates and their derivatives
7.5.2 Linked to the hydrolysis of a nucleoside triphosphate
7.5.2.6 ABC-type lipid A-core oligosaccharide transporter
KPNIH31_09015
Transporters [BR:
kpy02000
]
ABC transporters, eukaryotic type
ABCB (MDR/TAP) subfamily
ABCB-BAC subgroup
KPNIH31_09015
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_membrane
ABC_tran
SMC_N
AAA_16
Zeta_toxin
DEAD
AAA_22
DUF87
APS_kinase
AAA_29
AAA_15
AAA_25
nSTAND3
AAA_18
RsgA_GTPase
ABC_membrane_2
AAA_30
HUTI_composite_bact
AAA
NB-ARC
MMR_HSR1
AAA_24
Motif
Other DBs
NCBI-ProteinID:
AIX83743
UniProt:
A0A2X3HG54
LinkDB
All DBs
Position
1860554..1862302
Genome browser
AA seq
582 aa
AA seq
DB search
MQNDKDLSTWQTFRRLWPIIAPFKAGLIVAAVALVLNAGSDTFMLSLLKPLLDDGFGKTD
RSVLLWMPLVVIGLMVLRGITSYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQS
TGTLLSRITYDSEQVASSSSSALITVVREGASIIGLFVMMFYYSWQLSLILIVLAPIVSV
AIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLMFGGQEVETKRFDKVSNKMRLQ
GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDTLTAGTITVVFSSMIALMRPLKS
LTNVNAQFQRGMAACQTLFAILDSEQEKDEGTRVIERAKGNLKFENVTFTYPGREVAALR
NINLDIPEGKTVALVGRSGSGKSTIASLITRFYDVDEGQILLDGHDLREYKLSSLRDQVA
LVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVM
LSGGQRQRIAIARALLRNSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS
TIEQADEIVVVEDGRIVERGTHHDLLEHKGVYAQLHKMQFGE
NT seq
1749 nt
NT seq
+upstream
nt +downstream
nt
atgcagaacgataaagatctctccacgtggcagaccttccgccgactttggccgattatc
gcgccgtttaaagccgggctaatcgtagcggcggtggcgttggtgcttaacgcgggcagt
gacaccttcatgttatcgcttcttaaaccgttattggatgatggttttggtaaaacggat
cgctcagtgctgctatggatgccgctggtggttatcggcctgatggtgctgcgtgggatc
accagctacatctcgagctattgtatttcctgggtttccggcaaagtggtgatgaccatg
cgtcgtcgcctgttcggccacatgatgggtatgccggtggccttctttgacaagcagtct
accggaacgctgctgtcacgcatcacctatgattctgagcaggtcgcctcctcctcttcc
agcgcgctgatcaccgtggtccgcgaaggggcatcgattatcggtctgttcgtgatgatg
ttctattacagctggcagctgtcgctgatcctgatcgtactggcgccgattgtgtcggtg
gcgatccgcgtggtctccaagcgttttcgcaatatcagtaagaatatgcagaacacgatg
gggcaggtcaccaccagcgccgagcagatgctgaaagggcacaaagaggtgctgatgttt
ggcggccaggaagtggaaaccaaacgttttgataaagtcagcaataaaatgcgtctgcag
gggatgaagatggtttccgcctcgtctatctccgacccgatcattcagcttatcgcctcc
ctggcgctggcctttgtcctgtatgccgccagcttcccgagcgtgatggacaccctgacc
gccgggaccattaccgtggtcttctcctcgatgattgcgctgatgcgtccgctgaagtcg
ctgaccaacgtcaatgcccagttccagcgtgggatggcggcgtgccagacgctgtttgcg
atcctcgattccgagcaggaaaaagacgaaggtacgcgggtcattgagcgggcgaaaggc
aatctcaagttcgagaacgtcacctttacctacccgggtcgcgaagtggccgcgctgcgc
aatatcaatctcgatatcccggaagggaaaaccgtggcgctggtggggcgctcagggtcg
ggtaaatcgaccattgccagcctgatcacccgcttctacgatgtcgacgaggggcagatc
ctgctggatggccacgacctgcgcgagtacaagctgagctcactgcgcgatcaggtggcg
ctggtttcacagaacgtgcatctgttcaacgataccgtcgccaacaatatcgcctatgcc
cgtaccgaagagtacagccgcgagcagattgaagaggccgcgcgcatggcctacgccatg
gatttcattaacaagatggataatggtctggataccatcatcggcgagaatggcgtgatg
ctgtccggcggccagcgccagcgtattgctattgcccgcgcgctgctgcgtaacagcccg
atcctgatccttgatgaagccacctcggcgctggataccgagtccgagcgtgccattcag
gcggcgctggatgagctgcagaaaaaccgtacctcgctggttatcgctcaccgtctgtcg
accattgagcaggctgatgaaatcgtggtggttgaagacgggcggatcgtggagcgcgga
acgcaccatgacctgctggagcataagggcgtgtacgcccagctgcataagatgcaattc
ggcgaatga
DBGET
integrated database retrieval system