KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH31: KPNIH31_17805
Entry
KPNIH31_17805     CDS       T03467                                 
Name
(GenBank) NADH:ubiquinone oxidoreductase subunit J
  KO
K00339  NADH-quinone oxidoreductase subunit J [EC:7.1.1.2]
Organism
kpy  Klebsiella pneumoniae subsp. pneumoniae KPNIH31
Pathway
kpy00190  Oxidative phosphorylation
kpy01100  Metabolic pathways
Module
kpy_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kpy00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    KPNIH31_17805
Enzymes [BR:kpy01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     KPNIH31_17805
SSDB
Motif
Pfam: Oxidored_q3 DUF2109 Frizzled
Other DBs
NCBI-ProteinID: AIX85384
UniProt: A0A1Y0PVS9
LinkDB
Position
complement(3614607..3615161)
AA seq 184 aa
MEFAFYICGLIAILATLRVVTHTNPVHALLYLIISLLAIAGVFFSLGAYFAGALEIIVYA
GAIMVLFVFVVMMLNLGGTEIEQERKWLQPGIWIGPAILSAVLLVVIVYAILGINDQGID
GAAINAKEVGIALFGPYVLAVELASMLLLAGLVVAFHIGREERAGEVLSNRLNDSDKRKT
EEHA
NT seq 555 nt   +upstreamnt  +downstreamnt
atggaattcgctttttatatctgtggcctgatagccatcctcgcaaccttgcgggtcgtc
acccacaccaatccggtgcatgcgctgctgtacctgattatttcgctgctggcgattgcc
ggggtgttcttctcgctgggcgcgtacttcgccggagcgctggaaatcatcgtctacgcc
ggggccattatggtgctgttcgtcttcgtggtgatgatgctcaacctgggcggcaccgag
atcgaacaggagcgcaagtggctgcagccggggatctggattggcccggccatcctctcc
gcggtgctgctggtggttatcgtttacgccatcctgggcattaacgaccagggtatcgac
ggtgcggcgattaacgccaaagaagtgggcattgcgctgtttgggccgtacgtcctggcg
gtggagctggcctccatgctgctgctggcgggcctggtggttgccttccacattggccgc
gaagagcgcgccggcgaggtgctgagcaaccgtctgaacgacagcgacaaacgaaaaacg
gaggaacacgcatga

DBGET integrated database retrieval system