Klebsiella quasipneumoniae: AVR78_03685 Help Entry AVR78_03685       CDS       T04389                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism kqu  Klebsiella quasipneumoniae Brite KEGG Orthology (KO) [BR:kqu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:kqu03110]     AVR78_03685 Chaperones and folding catalysts [BR:kqu03110]  Protein folding catalysts   Protein disulfide isomerase    AVR78_03685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR CLIC-like_N GST_N Motif Other DBs NCBI-ProteinID:  AMR13520 UniProt:  A0A1C1ETA1 LinkDB All DBs Position complement(3621395..3621646) Genome browser AA seq 83 aa AA seqDB search MANIEIYTKATCPFCIRAKALLNSKGVTFHELPIDGDAAKREEMIQRSGRTTVPQIFIDA QHIGGCDDLYALDSRGGLDPLLR NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggccaatattgagatctacaccaaagcgacctgcccgttctgcatccgcgcgaaagcg ctgctgaacagcaaaggcgtaacgttccatgagttgccgatcgatggcgatgccgcgaag cgtgaggagatgatccagcgcagcggacggacgacggttccgcagatttttattgatgcg cagcacattggcggctgtgacgacttgtatgcgcttgattcacgtggtggacttgatccc ctcttgcgctaa

DBGET integrated database retrieval system