Klebsiella quasipneumoniae: AVR78_10380 Help Entry AVR78_10380       CDS       T04389                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism kqu  Klebsiella quasipneumoniae Brite KEGG Orthology (KO) [BR:kqu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:kqu03032]     AVR78_10380    03036 Chromosome and associated proteins [BR:kqu03036]     AVR78_10380    03400 DNA repair and recombination proteins [BR:kqu03400]     AVR78_10380 DNA replication proteins [BR:kqu03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AVR78_10380 Chromosome and associated proteins [BR:kqu03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AVR78_10380 DNA repair and recombination proteins [BR:kqu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AVR78_10380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AMR14729 UniProt:  A0A1C1EV11 LinkDB All DBs Position 5000820..5001092 Genome browser AA seq 90 aa AA seqDB search MNKSQLIDKIAAGADISKAAAGRALDALIASVTESLQAGDDVALVGFGTFAVKERAARTG RNPQTGKEITIAAAKVPGFRAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataaatctcaactgattgacaaaattgctgcgggtgcggacatttctaaagctgca gctggacgtgcgttagatgctttaatcgcttctgttactgaatctctgcaggctggggat gacgttgcgctggtaggtttcggtacctttgctgttaaagaacgtgccgcccgtactggt cgcaacccacaaacaggtaaagaaattactatcgctgccgcaaaagtgccgggcttccgt gctggtaaagcgctgaaagacgcggtgaactga

DBGET integrated database retrieval system