Klebsiella quasipneumoniae: AVR78_12395 Help Entry AVR78_12395       CDS       T04389                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism kqu  Klebsiella quasipneumoniae Pathway kqu00190   Oxidative phosphorylation kqu01100   Metabolic pathways kqu02020   Two-component system Module kqu_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:kqu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AVR78_12395  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     AVR78_12395 Enzymes [BR:kqu01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      AVR78_12395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AMR15102 UniProt:  A0A2A5MKF1 LinkDB All DBs Position 131457..131573 Genome browser AA seq 38 aa AA seqDB search MWYFAWILGTLLACAFGVITALALEHVEATKAGKKEEI NT seq 117 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttcgcatggattttgggaacgcttcttgcctgtgcctttggggtgattacc gcgctggcgcttgagcacgtggaagccaccaaagccgggaagaaagaagaaatctga

DBGET integrated database retrieval system