Klebsiella quasipneumoniae: AVR78_14505 Help Entry AVR78_14505       CDS       T04389                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kqu  Klebsiella quasipneumoniae Pathway kqu01100   Metabolic pathways kqu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kqu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AVR78_14505    00074 Mycolic acid biosynthesis     AVR78_14505   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AVR78_14505 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AMR15479 UniProt:  A0A1C1F1U1 LinkDB All DBs Position 560795..561031 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgagcagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system