KEGG   Klebsiella quasivariicola: B8P98_08525
Entry
B8P98_08525       CDS       T05116                                 
Name
(GenBank) MFS transporter
  KO
K26580  MFS transporter, ACS family, inner membrane transport protein
Organism
kqv  Klebsiella quasivariicola
Brite
KEGG Orthology (KO) [BR:kqv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kqv02000]
    B8P98_08525
Transporters [BR:kqv02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    B8P98_08525
SSDB
Motif
Pfam: MFS_1 Imm21 O-antigen_lig
Other DBs
NCBI-ProteinID: ASV19333
LinkDB
Position
1668256..1669545
AA seq 429 aa
MSNSLLESVVKKNRARLIPFMLALYVLAFLDRSNIGFAKETYQLDTGLSNEAYALGAGIF
FVVYAFLGVPANLLMRKFGARKWIGCTTLLWGVLSAAMAWADSEAKFLLVRTLLGAAEAG
FFPGMIYLTSQWFPQQNRASIMGLFYMGAPLALTLGSPLSGALLEMHGLMGHPGWFWMFV
IEGLLAIAAGAFTFFWLDDSPQQARFLSAEEKQVLIGELAREEEKKIASRLSDALRNGRV
WQLALIYLTIQVAVYGLIFFLPTQVAALLGTKVGFVASVVTAIPWVAALFGTWLIPRYSD
RTGERRNIAALTLLAAAVGIAVSGLVAPVLAIIALCVAAVGVIAVQPVFWTMPTQLLSGT
ALAAGIGFVNLFGAIGGFLAPIVRVQAETLFASSAAGLLTLAGVAIVGVIIIFSLSLTRA
VPQRGSVQH
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgagcaactctctgctggagagcgtggttaagaaaaaccgcgctcgcttaatccccttt
atgctggccctgtatgtgctggcgtttcttgaccgctccaatatcggttttgccaaggag
acgtatcagcttgataccgggctcagcaatgaagcctacgccctgggggccggtattttc
tttgtggtctacgcctttctcggggtaccggccaatctgctgatgcgtaaatttggcgcc
agaaaatggatcggctgcaccactctgctgtggggcgtgctgtcggcggcaatggcctgg
gcggacagcgaagcgaaatttcttctggtgcgtaccctgcttggtgcggcggaggcgggt
ttctttcccgggatgatctacctcacctcacagtggtttccccagcaaaaccgcgccagc
atcatggggctgttttatatgggggcgccgctggccctgacgctgggatcgcctttatcc
ggcgccctgctggagatgcatgggttaatgggccaccccggctggttctggatgtttgtc
attgaaggcctgctcgctatcgccgcgggagcgttcaccttcttctggctggacgactcg
ccgcagcaagctcgcttcctgagcgctgaggaaaaacaagtgctgatcggcgagctggcg
cgtgaggaggagaaaaagatcgcctcgcgcctgtccgatgcgctgcgtaacgggcgggtc
tggcagctggcgctgatttacctgaccatacaggtggcggtctatggcctgattttcttc
ctgcccactcaggtcgctgcgctgctgggcaccaaagtcggcttcgttgcctcggtggtg
acggctattccttgggtggcggcgctgttcggcacctggcttatccctcgctactccgat
cgcaccggcgagcggcgcaatattgccgcgctgacgctgctggcggcggcggttgggatt
gcggtgtccgggctggtggcgccggtgctggctatcatcgcgctgtgtgtggcggcggtt
ggtgtcattgccgtgcagccggtcttctggacgatgccgacgcagctgctgtccggcacg
gcgctggccgccgggattggcttcgttaacctgtttggcgccatcggcggctttctggcg
ccgatcgtgcgcgtgcaggccgaaaccctgttcgccagtagcgccgccggactgttaacc
ctggccggcgtcgctatcgtcggggtgattatcatcttctcattaagcctcacccgcgcg
gtaccccagcgcggcagcgtacagcattaa

DBGET integrated database retrieval system