Kosakonia radicincitans: A3780_04590 Help Entry A3780_04590       CDS       T04579                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism krd  Kosakonia radicincitans Brite KEGG Orthology (KO) [BR:krd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:krd03032]     A3780_04590    03036 Chromosome and associated proteins [BR:krd03036]     A3780_04590    03400 DNA repair and recombination proteins [BR:krd03400]     A3780_04590 DNA replication proteins [BR:krd03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     A3780_04590 Chromosome and associated proteins [BR:krd03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     A3780_04590 DNA repair and recombination proteins [BR:krd03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       A3780_04590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  APG16875 UniProt:  A0AAX2ELJ8 LinkDB All DBs Position 1000789..1001061 Genome browser AA seq 90 aa AA seqDB search MNKSQLIDKIAAGADISKAAAGRALDALIASVTESLKSGDDVALVGFGTFAVKERAARTG RNPQTGKEITIAAAKVPGFRAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaaatctcagctgattgacaagattgccgcaggtgctgatatttccaaagctgct gcaggacgtgcgttagatgctttaattgcttctgttactgaatctttgaaatccggggac gacgtagcactggtaggtttcgggactttcgcggttaaagaacgtgctgcacgcactggc cgtaacccgcagaccggcaaagaaatcactatcgctgcagctaaagtgccagggttccgc gcaggtaaagcgctgaaagacgcagtaaactga

DBGET integrated database retrieval system