Kribbella sp. CA-293567: OX958_12565 Help Entry OX958_12565       CDS       T10137                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kri  Kribbella sp. CA-293567 Pathway kri00998   Biosynthesis of various antibiotics kri01100   Metabolic pathways kri01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kri00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OX958_12565    00074 Mycolic acid biosynthesis     OX958_12565   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OX958_12565 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WBQ07606 LinkDB All DBs Position 2610723..2610968 Genome browser AA seq 81 aa AA seqDB search MDACLEQVMRAVLDLPVGAAIRPDQELESALGVDSLFLMSIVVGVEAERGIELSAASIGS VRTVGDLDRAVGEALGAVGEI NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggatgcctgcctggaacaagtcatgagagcggtcctcgacctgccggtgggagccgcc atccggcccgaccaagagctggaatcggcgctgggtgtggattcgctgttcctgatgagc atcgtcgtcggcgtcgaagccgagcgtggcatcgagttgagcgcggcctccatcggttcg gtccgtacggtcggcgatctggatcgcgcggtcggtgaggcgctgggagcagtcggtgaa atctga

DBGET integrated database retrieval system