Ketogulonicigenium robustum: BVG79_00908 Help Entry BVG79_00908       CDS       T04841                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kro  Ketogulonicigenium robustum Pathway kro01100   Metabolic pathways kro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BVG79_00908 (acpP)    00074 Mycolic acid biosynthesis     BVG79_00908 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BVG79_00908 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ARO14260 UniProt:  A0A1W6NYT6 LinkDB All DBs Position 895547..895711 Genome browser AA seq 54 aa AA seqDB search MEAASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAAETIQTFGDAVKFISEAQ NT seq 165 nt NT seq  +upstreamnt  +downstreamnt gtggaagctgcttcgttcatcgacgatctgggcgccgacagccttgacaccgttgaactg gtgatggctttcgaagaagaattcggcatcgagattcccgatgacgccgctgaaacgatc caaacgtttggcgatgcggtgaaattcatctccgaagctcaataa

DBGET integrated database retrieval system