Komagataeibacter saccharivorans: CD178_02015 Help Entry CD178_02015       CDS       T05634                                  Name (GenBank) DNA-binding protein HRL53   KO K03530   DNA-binding protein HU-beta Organism ksc  Komagataeibacter saccharivorans Brite KEGG Orthology (KO) [BR:ksc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ksc03032]     CD178_02015    03036 Chromosome and associated proteins [BR:ksc03036]     CD178_02015    03400 DNA repair and recombination proteins [BR:ksc03400]     CD178_02015 DNA replication proteins [BR:ksc03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CD178_02015 Chromosome and associated proteins [BR:ksc03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CD178_02015 DNA repair and recombination proteins [BR:ksc03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CD178_02015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Urease_beta DUF2267 HU-CCDC81_euk_2 HU-CCDC81_bac_2 Ribosomal_S5 Rpf1_C HU-CCDC81_bac_1 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AXY22774 UniProt:  A0A347WD31 LinkDB All DBs Position 2141314..2141601 Genome browser AA seq 95 aa AA seqDB search MEKPLNKQELVAAVAEEADLAKAKASEVVDAVFGAIEKALANKQEVRLVGFGTFVTATRK AAKGRNPRTGEPLDIPASTSVRFKPGKNLKEAVSK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggagaagccacttaacaagcaggaactcgttgctgcggtagccgaggaagccgatctg gcgaaggcaaaagccagcgaagtggttgatgcggttttcggtgcgatcgaaaaggcgctg gcaaacaagcaggaagtccgtctggtcggtttcggcacgttcgtgacggctacccgcaag gcagccaaggggcgtaacccccgcacgggtgagccgctggacattccggcttccacttcc gtccgtttcaagccgggcaagaacctgaaggaagctgtcagcaagtaa

DBGET integrated database retrieval system