Kangiella sediminilitoris: KS2013_151 Help Entry KS2013_151        CDS       T04467                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism ksd  Kangiella sediminilitoris Brite KEGG Orthology (KO) [BR:ksd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ksd03036]     KS2013_151 Chromosome and associated proteins [BR:ksd03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     KS2013_151 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB HALZ ODAD1_CC bZIP_1 TSC22 GAS OVT1 FlaC_arch Taxilin YabA KASH_CCD DUF7310 DUF16 COG3_N PilJ APG6_N DUF7491 Wtap DivIC NRBF2 DUF3450 HAUS-augmin3 ATG14 Alanine_zipper DUF4140 CCDC138_cc TolA_bind_tri TMF_DNA_bd INO80F MctB Csm1_N FapA Motif Other DBs NCBI-ProteinID:  AOE48880 UniProt:  A0A1B3B7W1 LinkDB All DBs Position complement(153797..153994) Genome browser AA seq 65 aa AA seqDB search MTNSQFEQLEEKIDALLARFNVIDNENQQLRQQVNELRVERDRLQSRNESARKQIDLMIS RLKSL NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgaccaacagtcaatttgaacaattagaagaaaaaattgacgccttattggcgcgcttt aatgtgatcgataacgagaaccaacaactgcgccaacaggttaatgagttacgagtagag cgcgatcgtctgcagagccgtaatgaatcggctcgtaaacagatagatctaatgatttct cgtttaaaatcattataa

DBGET integrated database retrieval system