Kineothrix sedimenti: V6984_13935
Help
Entry
V6984_13935 CDS
T10997
Name
(GenBank) glycine--tRNA ligase
KO
K01880
glycyl-tRNA synthetase [EC:
6.1.1.14
]
Organism
ksi Kineothrix sedimenti
Pathway
ksi00970
Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:
ksi00001
]
09120 Genetic Information Processing
09122 Translation
00970 Aminoacyl-tRNA biosynthesis
V6984_13935
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
ksi01007
]
V6984_13935
09182 Protein families: genetic information processing
03016 Transfer RNA biogenesis [BR:
ksi03016
]
V6984_13935
03029 Mitochondrial biogenesis [BR:
ksi03029
]
V6984_13935
Enzymes [BR:
ksi01000
]
6. Ligases
6.1 Forming carbon-oxygen bonds
6.1.1 Ligases forming aminoacyl-tRNA and related compounds
6.1.1.14 glycine---tRNA ligase
V6984_13935
Amino acid related enzymes [BR:
ksi01007
]
Aminoacyl-tRNA synthetase
Class II (C/G)
V6984_13935
Transfer RNA biogenesis [BR:
ksi03016
]
Eukaryotic type
Aminoacyl-tRNA synthetases (AARSs)
Other AARSs
V6984_13935
Mitochondrial biogenesis [BR:
ksi03029
]
Mitochondrial DNA transcription, translation, and replication factors
Mitochondrial transcription and translation factors
Other mitochondrial DNA transcription and translation factors
V6984_13935
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
HGTP_anticodon
tRNA-synt_2b
PHD_pln
Zn_ribbon_PaaD
DUF4931_N
Motif
Other DBs
NCBI-ProteinID:
XAH72607
UniProt:
A0ABZ3ESF1
LinkDB
All DBs
Position
complement(2900574..2901962)
Genome browser
AA seq
462 aa
AA seq
DB search
MEKTMEKIVALAKARGFVYPGSEIYGGLANTWDYGNLGVELKNNVKRAWWQKFIMENQYN
VGVDCAILMNPQTWVASGHLGGFSDPLMDCKECHERFRADKIIEDYAAEYNVALDGSVDG
WSQEKMKQFIEDNNIPCPTCGKHNFTDIRQFNLMFKTFQGVTEDAKNTVYLRPETAQGIF
VNFKNVQRTSRKKIPFGIGQVGKSFRNEITPGNFTFRTREFEQMELEFFCEPDTDLEWFA
YWKQFCIDWLKTLGMKDEEMRVRDHDKEELSFYSKATTDIEFLFPFGWGELWGIADRTDY
DLTQHQNTSGQDLTYFDDQKNIRYVPYVIEPSLGADRVVLAFLCAAYDEEEIGEGDVRTV
LHFHPALAPVKIGVLPLSKKLNEGAEKIFMELSKKYNCEFDDRGNIGKRYRRQDEIGTPF
CITYDFESETDNCVTVRFRDSMDQERVAIADLDAYFADKFTF
NT seq
1389 nt
NT seq
+upstream
nt +downstream
nt
atggaaaaaacaatggagaaaatagtagcactggcgaaagcgagaggatttgtatatccc
ggctctgagatttacggcgggcttgccaatacatgggattatggtaaccttggtgtggaa
ctgaagaacaacgtgaaacgcgcgtggtggcagaaattcatcatggagaaccagtataat
gtgggtgtggactgcgcaatacttatgaatccccagacttgggtggcttcgggacatctg
ggaggtttctcggatcctttgatggactgcaaggaatgtcacgagcggttccgggcagat
aaaattatcgaggattatgcggcagaatataatgttgctttggatggctccgtagacggt
tggtctcaagagaaaatgaagcagtttatcgaagacaacaacattccctgtcctacctgc
ggcaaacataatttcacagatatccgccagttcaatctgatgttcaagacgtttcaggga
gtgacggaggatgcgaagaacacagtttacttaagaccggaaaccgcacagggcatcttt
gtgaactttaagaacgtacagagaacatccagaaagaagattcccttcggtatcggtcag
gtagggaaatccttccgcaacgaaattacaccgggcaatttcactttccgcacaagagaa
ttcgagcagatggaactggaatttttctgtgagccggatacggatcttgagtggttcgca
tactggaagcagttctgtatcgactggctgaagacactcggcatgaaggacgaagagatg
cgcgtcagagatcacgataaggaagagctttccttctactccaaggctaccacggatatc
gagtttttattccccttcggttggggcgagttgtggggaattgcagataggaccgattat
gatcttacccagcaccagaacacctcggggcaggatttgacttattttgatgatcagaag
aacataagatacgtaccgtatgttattgagccgtctctcggcgcggaccgcgtagttttg
gcttttctttgtgcggcctacgatgaagaggaaatcggagaaggcgatgtacgaaccgta
cttcatttccatccggcgctggccccggttaagatcggagtgcttccactgtccaagaag
ttaaacgaaggtgcagagaaaatattcatggagttgtcaaagaaatataactgtgaattt
gacgacagaggaaatatcggaaaaagataccgcagacaggatgagataggaactccgttt
tgtattacttatgatttcgaatccgagacagacaattgcgttaccgtacgcttccgtgat
tctatggatcaggagcgtgtggccattgctgacctcgacgcatattttgcggataaattt
accttttaa
DBGET
integrated database retrieval system