Kitasatospora setae: KSE_42380 Help Entry KSE_42380         CDS       T01648                                  Symbol acpP3 Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism ksk  Kitasatospora setae Pathway ksk00998   Biosynthesis of various antibiotics ksk01100   Metabolic pathways ksk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ksk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KSE_42380 (acpP3)    00074 Mycolic acid biosynthesis     KSE_42380 (acpP3)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KSE_42380 (acpP3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DEK_C Motif Other DBs NCBI-ProteinID:  BAJ30023 UniProt:  E4MZT9 LinkDB All DBs Position 4697114..4697404 Genome browser AA seq 96 aa AA seqDB search MSTATFEDVRAQAEQRLERNLRIKSMIIDRLGLDAEAEVVSDNQPLFGRGLEMDSLDTLE IVVMINNEYDVLISDDDFEAFGSINALVDFIEAREV NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgtccaccgccaccttcgaggacgtccgcgcccaggccgagcagcgcctggagcggaac ctgaggatcaagtcgatgatcatcgaccgcctgggcctggacgccgaggccgaggtcgtc tccgacaaccagccgctgttcggccgcggcctggagatggactcgctggacaccctggag atcgttgtcatgatcaacaacgagtacgacgtgctgatcagcgacgacgacttcgaggcg ttcggctccatcaacgccctggtcgacttcatcgaagcccgcgaggtctga

DBGET integrated database retrieval system