Kitasatospora setae: KSE_58090 Help Entry KSE_58090         CDS       T01648                                  Name (GenBank) hypothetical protein   KO K05553   minimal PKS acyl carrier protein Organism ksk  Kitasatospora setae Pathway ksk00253   Tetracycline biosynthesis ksk01056   Biosynthesis of type II polyketide backbone ksk01100   Metabolic pathways ksk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ksk00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     KSE_58090    00253 Tetracycline biosynthesis     KSE_58090  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:ksk01004]     KSE_58090    01008 Polyketide biosynthesis proteins [BR:ksk01008]     KSE_58090 Lipid biosynthesis proteins [BR:ksk01004]  Polyketide synthase   Component type    KSE_58090 Polyketide biosynthesis proteins [BR:ksk01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      KSE_58090     Nonaketide PKS      KSE_58090     Decaketide PKS      KSE_58090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BAJ31580 UniProt:  E4N3U9 LinkDB All DBs Position complement(6500745..6501011) Genome browser AA seq 88 aa AA seqDB search MKAFSSSALEDLMQLCLPPDRRLAADGEELLDLSFRALGFDSLAMVELADRLQEALRVPV PTEAMDRIATPRAALAYVERLLAAGERG NT seq 267 nt NT seq  +upstreamnt  +downstreamnt gtgaaagctttctcctcctccgccctggaagacctcatgcagctctgcctgccccccgac cgccgactcgccgccgacggcgaggaactgctcgacctgtccttccgcgccctgggcttc gactcgctggcgatggtcgaactcgccgaccgcctccaggaggcgctgcgggtgcccgtc ccgaccgaggcgatggaccggatcgccacgccccgggccgcgctcgcctacgtcgagcgc ctcctcgccgcgggggaacgcggatga

DBGET integrated database retrieval system