KEGG   Kribbella soli: OG809_33950
Entry
OG809_33950       CDS       T09724                                 
Name
(GenBank) M56 family metallopeptidase
  KO
K02172  bla regulator protein blaR1
Organism
ksl  Kribbella soli
Pathway
ksl01501  beta-Lactam resistance
Module
ksl_M00627  beta-Lactam resistance, Bla system
Brite
KEGG Orthology (KO) [BR:ksl00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    OG809_33950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ksl01002]
    OG809_33950
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:ksl01504]
    OG809_33950
Peptidases and inhibitors [BR:ksl01002]
 Metallo peptidases
  Family M56
   OG809_33950
Antimicrobial resistance genes [BR:ksl01504]
 Gene sets
  beta-Lactam resistance modules
   beta-Lactam resistance, Bla system [MD:M00627]
    OG809_33950
SSDB
Motif
Pfam: Peptidase_M48 Peptidase_M56 DUF202 SprT-like
Other DBs
NCBI-ProteinID: WUJ70084
LinkDB
Position
6894236..6895141
AA seq 301 aa
MNISTHVLLLTGYATTITTCAPRLLSRSSLPRRSPGLALALWHTSIASAGFAISLVAIKL
ISTALLLPTGPPQPDGQPGSMAETLVAVAAGLFIVAYGSARLFRSTTHVLRAQRTGRRRH
LELLSLLGRYDSELDATIVPSPAAAAYCVTGTNQVVITEHALRLLGPDQLAAVLAHERAH
LTGRHHLLVTWATLLMDAFPGVTALVQLREATSNLVELLADDKALRQVKPGSLAGAIALL
SRGAPEGRLAATGGQTLVRVERLLDPPPRLWPPVIIACAVVTPLIVGIPLLLASYPASTP
C
NT seq 906 nt   +upstreamnt  +downstreamnt
atgaacatctcgacgcatgtcctgctgctgaccggctacgcgacgaccatcacgacctgc
gctccacgcctgctgtccaggtcgagcctgccgcgacggtcgccaggactcgcgctggcc
ctgtggcacacctcgatcgcatccgccggattcgcgatcagcctcgtcgcgatcaagctc
atctcgaccgcgcttctgctgccgaccggaccacctcagccagacggccaaccaggctcg
atggccgagaccttggtggcggtggcggcagggctgttcatcgttgcctatgggtccgcc
cggctgttccgctcaactactcatgtcctccgcgcgcagcgcaccggacgccggcgacat
ctcgagcttctctcgctcctcggtcgctacgactctgagcttgatgcaaccatcgtcccg
tctccggcggccgctgcgtactgcgtgaccggcaccaaccaggtcgtgatcaccgagcac
gctctcaggctcctggggccggaccaactggccgcggtcctcgcccacgaacgcgcccac
ctgaccggtcggcatcacctcctggttacctgggccactctgctcatggatgcgtttccg
ggcgtcacggctctcgttcaattgcgcgaggcgacgtcgaaccttgtcgagttgctcgcc
gacgacaaagccctgagacaggtgaagcccggtagcctggccggcgcgatcgccctactt
agccgaggcgcacccgagggccgccttgctgcgacgggcggacagacccttgtccgcgtg
gagcgactgcttgacccaccaccaaggctgtggccaccggtcatcatcgcctgcgccgtg
gtgacacccctcatagttgggattcctctgctcctcgccagctacccagccagcaccccc
tgctaa

DBGET integrated database retrieval system