KEGG   Candidatus Kuenenia stuttgartiensis: KSMBR1_1220
Entry
KSMBR1_1220       CDS       T05435                                 
Symbol
hdh
Name
(GenBank) hydrazine dehydrogenase
  KO
K20935  hydrazine dehydrogenase [EC:1.7.2.8]
Organism
kst  Candidatus Kuenenia stuttgartiensis
Pathway
kst00910  Nitrogen metabolism
kst01100  Metabolic pathways
kst01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kst00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    KSMBR1_1220 (hdh)
Enzymes [BR:kst01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.8  hydrazine dehydrogenase
     KSMBR1_1220 (hdh)
SSDB
Motif
Pfam: Multi-haem_cyto Cytochrom_c3_2
Other DBs
NCBI-ProteinID: SOH03722
UniProt: Q1PYC5
LinkDB
Position
MBR1:complement(1318429..1320162)
AA seq 577 aa
MRKFLKVTLASALIGCGVIGTVSSLMVKEAKAVEIITHWVPHEVYGMPGEPDNSGKVFFS
GLKAKYMGYPKDAQRSPYPGKYSKFWKTLPAYRYYIPDYMYNRDEVRPSNPIKGTFKLEQ
CVACHSVMTPGIVRDYNKSAHSKAEPAPTGCDTCHGNNHQKLTMPSSKACGTAECHETQY
NEQGQGGIGSHASCSSFAQVECAWSIERPPGDTAGCTFCHTSPEERCSTCHQRHQFDPAV
ARRSEQCKTCHWGKDHRDWEAYDIGLHGTVYQVNKWDTEQFDFSKKLSDADYVGPTCQYC
HMRGGHHNVQRASIVYTSMGMSMADRGAPLWKEKRDRWVSICDDCHSPRFARENLQAMDE
SVKDASLKYRETFKVAEDLLIDGVLDPMPKDLCPDWSGQHIWSLKIGAYHDGEAYGGKTG
ESGEFRMSNVTDVERLCFESVGYFQTYIYKGMAHGSWNDATYSDGSFGMDRWLVNVKQNA
SRARRLAALEKKVGISWQPEQFWKTGEWLDQLTGPYIVKNHPGKTIFDLCPDPGWLDTHH
APAEEVEYIERKLKELGMEAGTHDVKQDSESKSVREH
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgcgtaaatttttgaaagttacattggcatcagcgttgattggttgtggcgttataggt
actgtttcaagccttatggtgaaagaagccaaggctgtagaaattatcactcactgggta
ccacacgaagtttatggtatgcctggggagcctgataatagtggtaaggtatttttctct
ggtttgaaagcaaaatatatgggttacccaaaagatgcacagaggtcaccatacccggga
aaatacagcaagttttggaagacattgcctgcgtaccgttattacatcccggattatatg
tacaacagggatgaggtaaggccttcaaacccgattaagggcacatttaagctggagcag
tgtgttgcttgtcactcagttatgactcccggcattgtaagggattataataagagtgct
cattcaaaggcagagccggcaccaactggttgtgatacctgccacggcaacaaccatcag
aagttaactatgccttcatcaaaggcttgcgggacagcggaatgtcacgaaacgcagtac
aatgagcaagggcagggaggaattggttcccacgcatcttgttccagtttcgctcaggtt
gagtgtgcatggtcaattgaaaggccacccggagatacagcgggttgtactttctgccat
accagccctgaagaaaggtgcagcacttgccaccagaggcatcagtttgatccggcagtt
gcaagacgctccgagcaatgcaagacctgtcactggggtaaagatcacagggattgggaa
gcttatgatataggtcttcatggtacggtatatcaggttaacaagtgggatacggaacag
tttgacttctcaaagaagctttctgatgctgattacgttggtcctacctgccagtactgt
catatgaggggcgggcatcataacgtgcagagagcaagtatcgtatataccagtatgggt
atgtcgatggctgatcgtggtgcaccactctggaaggaaaagagagaccgttgggtatct
atctgtgacgactgtcattcaccaagattcgcccgcgagaatttgcaggcgatggacgag
tctgttaaagacgctagtttgaagtatcgtgaaacattcaaggtagcggaagatcttctt
attgacggtgtactagaccccatgccaaaggatctttgtcctgattggtcaggtcagcac
atctggagtttgaagattggcgcgtaccatgatggagaagcttacggtggtaagactggc
gaatccggagagtttagaatgtcaaacgttactgatgtggagaggctttgttttgaaagt
gttggttacttccagacatacatttacaagggcatggcgcacggctcctggaatgatgct
acctactcagacggttcattcggtatggatcgttggttggtcaacgtaaagcagaatgct
tcacgtgcaagaaggcttgctgctttggaaaagaaggttggtatttcatggcagcctgag
cagttctggaaaacaggcgaatggctggatcagttgaccgggccatatatcgtaaagaat
caccctggcaagacgatcttcgatctttgtccagatccaggctggttagacacacatcat
gcacctgctgaagaggttgagtacattgagagaaaactcaaggaactcggcatggaagct
ggtactcatgatgttaaacaggattctgaatcaaagtctgtgagagaacattga

DBGET integrated database retrieval system