Candidatus Kuenenia stuttgartiensis: KSMBR1_3472 Help Entry KSMBR1_3472       CDS       T05435                                  Symbol acpP_2 Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism kst  Candidatus Kuenenia stuttgartiensis Pathway kst01100   Metabolic pathways kst01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kst00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KSMBR1_3472 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KSMBR1_3472 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  SOH05946 UniProt:  Q1Q2X6 Structure PDB LinkDB All DBs Position MBR1:3746751..3747011 Genome browser AA seq 86 aa AA seqDB search MNDEEIEKGVTSIVAEVTELDEKEIWEKRDANFFQDLEIDSLLALEILALIEKKFKVQIP EEKLVDITSLSATIGLTKSVLAESGK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt ttgaacgacgaagagattgaaaaaggtgtaacctcaatagttgcagaggttacagagctg gatgaaaaagagatctgggagaaaagggatgcgaatttttttcaggaccttgaaattgat tctcttctggcgcttgagattttagcgcttatagaaaaaaaatttaaagtgcaaattcca gaagaaaaacttgtagatattacttctttgagcgccacgattggtttaacaaaatcggtt ttggcagagagtgggaagtaa

DBGET integrated database retrieval system