Candidatus Kuenenia stuttgartensis: KSMBR1_3936 Help Entry KSMBR1_3936       CDS       T05435                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism kst  Candidatus Kuenenia stuttgartensis Pathway kst03060   Protein export kst03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:kst00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     KSMBR1_3936  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     KSMBR1_3936  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:kst02044]     KSMBR1_3936 Secretion system [BR:kst02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    KSMBR1_3936 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E HHH_3 DUF948 Motif Other DBs NCBI-ProteinID:  SOH06408 UniProt:  A0A2C9CLE5 LinkDB All DBs Position MBR1:4254902..4255111 Genome browser AA seq 69 aa AA seqDB search MFSIPGGWEWIIIALIAFLIFGKRLPGIMKNVGRSIAEFRKGFKNVEEEINEVKEIKGNI DTITKFKIN NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgttttccataccaggtggttgggagtggattataatcgcgttaattgcttttctcata tttggcaaaagactgcctggcattatgaaaaatgtcggaagaagtattgctgagttcagg aagggctttaaaaacgttgaagaagaaataaacgaagtgaaagaaataaaaggcaatatc gatactattactaaatttaagattaattga

DBGET integrated database retrieval system