Komagataeibacter sucrofermentans: ACM0P6_00205 Help Entry ACM0P6_00205      CDS       T11177                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ksu  Komagataeibacter sucrofermentans Pathway ksu01100   Metabolic pathways ksu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ksu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACM0P6_00205    00074 Mycolic acid biosynthesis     ACM0P6_00205   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACM0P6_00205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  XOO50489 LinkDB All DBs Position 45365..45604 Genome browser AA seq 79 aa AA seqDB search MSEIADKVKKIVVEHLGVDESKVTPDASFIDDLGADSLDTVELVMAFEEAFSVEIPEDAA EKITTVKDAIDYIEKQKAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaatcgccgataaggttaagaagatcgtagtcgagcaccttggtgttgacgaa agcaaggtcaccccggatgcctctttcatcgacgatctgggcgccgacagcctcgacacg gtcgagctggtcatggcgttcgaggaagcgttcagcgtcgagatccccgaggatgcggct gaaaagatcacgaccgtgaaggacgcgatcgactacatcgaaaagcagaaagctgcctga

DBGET integrated database retrieval system