Komagataeibacter sucrofermentans: ACM0P6_12265 Help Entry ACM0P6_12265      CDS       T11177                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism ksu  Komagataeibacter sucrofermentans Pathway ksu02024   Quorum sensing ksu03018   RNA degradation Brite KEGG Orthology (KO) [BR:ksu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     ACM0P6_12265 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     ACM0P6_12265 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ksu03019]     ACM0P6_12265 (hfq)    03036 Chromosome and associated proteins [BR:ksu03036]     ACM0P6_12265 (hfq) Messenger RNA biogenesis [BR:ksu03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      ACM0P6_12265 (hfq) Chromosome and associated proteins [BR:ksu03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     ACM0P6_12265 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  XOO50131 LinkDB All DBs Position 2568325..2568603 Genome browser AA seq 92 aa AA seqDB search MAKEPSQNVQDVFLNHVRRSKTPVTIFLVNGVKLQGIITWFDNFFVLLRRDGHTQLVYKH AISTVMPATPVSLFDPPAEDTEEPAATDGSPS NT seq 279 nt NT seq  +upstreamnt  +downstreamnt gtggcaaaagaaccttcacagaatgtacaggacgtgtttctcaaccacgtccgccggtcg aaaacgccggtcaccattttcctcgtcaatggcgtcaagcttcagggcatcatcacctgg tttgacaattttttcgttctgctgcggcgcgacgggcatacgcagcttgtctacaagcac gcgatcagcaccgtcatgcccgccacccccgtcagcctgtttgatcccccggctgaggat acggaagaacctgctgccacggatggcagcccgtcgtga

DBGET integrated database retrieval system