Kushneria konosiri: B9G99_01905 Help Entry B9G99_01905       CDS       T04839                                  Name (GenBank) hypothetical protein   KO K03707   thiaminase (transcriptional activator TenA) [EC:3.5.99.2] Organism kus  Kushneria konosiri Pathway kus00730   Thiamine metabolism kus01100   Metabolic pathways kus01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:kus00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00730 Thiamine metabolism     B9G99_01905  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:kus03000]     B9G99_01905 Enzymes [BR:kus01000]  3. Hydrolases   3.5  Acting on carbon-nitrogen bonds, other than peptide bonds    3.5.99  In other compounds     3.5.99.2  aminopyrimidine aminohydrolase      B9G99_01905 Transcription factors [BR:kus03000]  Prokaryotic type   Other transcription factors    Others     B9G99_01905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TENA_THI-4 Motif Other DBs NCBI-ProteinID:  ARS51803 UniProt:  A0A2Z2H3L0 LinkDB All DBs Position 396974..397288 Genome browser AA seq 104 aa AA seqDB search MGYCFTDLINTCPNDWRAYIEHDFVRQLGAATLSEESFRHYLKQDYLFLIHFARAWGLAV YKSRDMTELRHSLDNLKTIVDTEMGLHVTYCREWGIDESFSAFS NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgggctactgctttactgacctgatcaacacttgtccgaacgactggcgcgcctacatc gagcacgatttcgtgcgacaacttggcgccgccacgctctccgaggaatcctttcgtcac tacctgaagcaggactatctgtttctgatccactttgcgcgcgcctgggggctggcggtc tataaaagccgcgacatgacggagcttcgtcactcgctggacaatttaaagaccatcgtg gacaccgaaatggggctgcacgtcacctactgccgggaatggggcattgatgagagcttt tcagctttctcataa

DBGET integrated database retrieval system