Kushneria konosiri: B9G99_02175 Help Entry B9G99_02175       CDS       T04839                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kus  Kushneria konosiri Pathway kus01100   Metabolic pathways kus01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kus00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B9G99_02175    00074 Mycolic acid biosynthesis     B9G99_02175   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B9G99_02175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ARS51848 UniProt:  A0A2Z2H3X2 LinkDB All DBs Position 463163..463438 Genome browser AA seq 91 aa AA seqDB search MANTALTDLERDVANMIIEALELEDITADDIEPEAPLFGDGLGLDSIDALELGLALQKRY GIRLDSDAEENREHFASLRQLSALVAERRND NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggccaatacggcattgaccgatcttgaacgcgatgttgccaacatgatcatcgaagcg ctggagcttgaagacattacagccgacgacatcgagcccgaagcgcccctgtttggcgac gggctggggctggactcgatcgatgcactggagctgggtctggcgctgcaaaagcgttac ggcatccgactggacagcgatgccgaggaaaaccgcgagcactttgccagcctcagacag ctcagcgcgctggtcgccgagcgtcgcaacgactga

DBGET integrated database retrieval system