KEGG   Kushneria konosiri: B9G99_09430
Entry
B9G99_09430       CDS       T04839                                 
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
kus  Kushneria konosiri
Pathway
kus00770  Pantothenate and CoA biosynthesis
kus01100  Metabolic pathways
kus01240  Biosynthesis of cofactors
Module
kus_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:kus00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    B9G99_09430
Enzymes [BR:kus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     B9G99_09430
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: ARS53078
UniProt: A0A2Z2H6Z0
LinkDB
Position
complement(2051361..2051843)
AA seq 160 aa
MNIVVYPGTFDPITNGHTDLIERAASMFDRVIVAVAQSPRKQPTLSLDERVQLAREILGH
LGNVEVVGFSCLLTQLVDRVGARIILRGLRAVSDFEYELQLANMNRALAPHVESLFLTPE
VENSYISSTIVREIARLGGDVSSMVHPRIAQALEEHFQGA
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaacattgtggtgtatcctggaacctttgatccgatcaccaatggtcataccgacctg
atcgagcgcgcggcatcgatgtttgatcgggtcatcgtcgccgtggcgcaaagcccgcgc
aagcagccgaccctgtcgctcgatgagcgggtgcagcttgcccgggaaattctgggccat
cttggcaatgtcgaagtcgtcggattcagctgtcttttgacccaactggtggatcgggtt
ggcgcacgcattattctgcgcggactgagagccgtgtcggatttcgagtacgagctgcag
ctggccaacatgaaccgggcactggccccccatgttgaaagtctttttttgacgcctgaa
gtcgagaattcctatatttcatccaccatcgtgcgtgaaatcgcccgccttggcggtgac
gtttcatcgatggtgcatccccgcatcgcccaggcgctggaagaacattttcagggcgcc
tga

DBGET integrated database retrieval system