Kutzneria sp. CA-103260: JJ691_07450 Help Entry JJ691_07450       CDS       T08943                                  Symbol acpP_1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism kut  Kutzneria sp. CA-103260 Pathway kut00998   Biosynthesis of various antibiotics kut01100   Metabolic pathways kut01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kut00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JJ691_07450 (acpP_1)    00074 Mycolic acid biosynthesis     JJ691_07450 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JJ691_07450 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QUQ63033 LinkDB All DBs Position complement(865973..866245) Genome browser AA seq 90 aa AA seqDB search MTNTEVHAIVAAMAPSPRAELRADTRLVADLAYDSVRLIELSIALERHFALAALDESRLA AVTTVGDVVDLVAEQLAAGDLGAGDLGAVR NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaccaacaccgaggtgcacgccatcgtggccgcgatggcgccgagcccgcgcgccgag ctgcgcgccgacacccgcctggtcgccgacctcgcctacgactcggtgcggctgatcgag ctgtccatcgcgctggagcggcacttcgccctggccgccctggacgagagccggctggcc gcggtgaccaccgtcggcgacgtcgtcgacctggtggccgaacaactggcggccggggat ctgggggccggggatttgggggcggtccgatga

DBGET integrated database retrieval system