Kushneria phosphatilytica: FY550_03250 Help Entry FY550_03250       CDS       T06200                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kuy  Kushneria phosphatilytica Pathway kuy01100   Metabolic pathways kuy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kuy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FY550_03250    00074 Mycolic acid biosynthesis     FY550_03250   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FY550_03250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QEL10250 UniProt:  A0A1S1NLV2 LinkDB All DBs Position complement(748173..748421) Genome browser AA seq 82 aa AA seqDB search MTRHEQILERLMQHLERFSSESGELHADADLVNELGLDSVNVMDLLLDIEDEFDISVPIN LITDVRTPRQLADVIVKIESGE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacgcgacacgaacagatactcgagcgactgatgcagcatctggagcgtttcagctcg gaaagtggagaactgcacgccgacgccgatctggtcaatgaacttggcctggactcggtc aatgtgatggacctgctgcttgatatcgaggacgagttcgacatctcggtgccgatcaat ctgatcaccgatgtacgtacaccccgccagttggccgatgtcatcgtgaagatcgagagt ggcgaatga

DBGET integrated database retrieval system