Kushneria phosphatilytica: FY550_12490 Help Entry FY550_12490       CDS       T06200                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism kuy  Kushneria phosphatilytica Pathway kuy01100   Metabolic pathways kuy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:kuy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FY550_12490    00074 Mycolic acid biosynthesis     FY550_12490   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FY550_12490 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QEL11872 UniProt:  A0A1S1NYT9 LinkDB All DBs Position 2717633..2717908 Genome browser AA seq 91 aa AA seqDB search MAETAQTPLERSLAEMVIETLELEDITVDDIDPEAPLFGEGLGLDSIDALELGLALQKHY GIRLDSDSEDNQTHFASLRNLAALVEARRTT NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggctgagactgcccagaccccacttgaacgctccctggccgaaatggtcatcgagacc ctcgagctcgaagacatcacggtcgatgacattgatcccgaagcgcctctgttcggagag ggccttgggctggactcgatcgacgcactggaactggggctggcgctgcaaaagcactac ggcatccgcctggacagcgacagtgaagacaatcagacgcacttcgccagcctgcgcaat ctggccgcgctggttgaagcacgccgcaccacctga

DBGET integrated database retrieval system