Lysobacter antibioticus 76: LA76x_0253 Help Entry LA76x_0253        CDS       T04154                                  Name (GenBank) fabA-like domain protein Organism lab  Lysobacter antibioticus 76 Pathway lab00061   Fatty acid biosynthesis lab00780   Biotin metabolism lab01100   Metabolic pathways lab01212   Fatty acid metabolism lab01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:lab00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LA76x_0253   09108 Metabolism of cofactors and vitamins    00780 Biotin metabolism     LA76x_0253  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:lab01004]     LA76x_0253 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PKS_DH_N FabA ApeI-like Motif Other DBs NCBI-ProteinID:  ALN78415 UniProt:  A0A0S2F4C5 LinkDB All DBs Position 286789..287094 Genome browser AA seq 101 aa AA seqDB search MPFSIPSDHPCLPGHFPGHPLVPGVVLLEQVIATVEAAYGPLSGLRLPQVKFLQPLLPEQ SAQVELDALGAARWRFRVRRGEDLLASGEVVADLPITEASA NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccgttctcgatcccgtccgatcatccctgtctgcccggccatttcccggggcacccg ctggtgcccggcgtggtcctgctggagcaggtgatcgccacggtcgaagccgcgtacggg ccgctgagcggattgcgtctgccgcaggtgaagttcttgcagcccttgttgccggagcaa tcggcgcaggtcgaactggacgcgctgggcgcggcgcgttggcgctttcgcgtgcgccgc ggcgaggacctgctcgccagcggcgaagtcgtcgccgacctgcccatcaccgaggcttcg gcatga

DBGET integrated database retrieval system