KEGG   Labrenzia sp. THAF35: FIU93_06955
Entry
FIU93_06955       CDS       T06351                                 
Name
(GenBank) hypothetical protein
  KO
K20266  type IV secretion system protein TrbJ
Organism
labt  Labrenzia sp. THAF35
Pathway
labt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:labt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    FIU93_06955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:labt02044]
    FIU93_06955
Secretion system [BR:labt02044]
 Type IV secretion system
  Trb secretion system protein
   FIU93_06955
SSDB
Motif
Pfam: DUF4141 DUF948 TruB_C Mod_r DUF3535 DUF1522 DUF6746 Hypoth_Ymh DUF5929 FapA PLU-1
Other DBs
NCBI-ProteinID: QFT66510
LinkDB
Position
1499880..1500635
AA seq 251 aa
MTFRRSRAVVAAAAILSAPFLSSVTFAPPAFAWRVVFDPSNYAQNVLTAARTLEQINNQI
VQLQNEAQMLINQARNLASLPYSALQQLQQSVQRTQQLLEEAQNIAFDVQQIDQLFQQQY
GNIDLSASEQQLVAGARSRWQNTVGGLQDALRVQAGVVGNIETNRAQMSALIGQSQGATG
ALQTAQAGNQLLALQAQQLSDLTAVVAANGRAIALSEAERTAAAEQGRIQRQRFLSPGSG
YQPGNARMFNN
NT seq 756 nt   +upstreamnt  +downstreamnt
atgacgttccgccgatcccgtgccgttgtcgctgctgccgcaattctgagtgcgccattt
ctcagctctgtcacgttcgccccgccggcttttgcctggcgtgtcgtgttcgatccgtcg
aactatgcccagaatgtgctgacggcggcacggacgctggagcagatcaacaaccagatc
gtccagcttcagaacgaagcgcagatgctgatcaaccaggctcgcaatctggccagcctt
ccttattcggctttgcagcagctccagcaatccgtgcagaggacgcagcagcttcttgag
gaggctcagaacatcgctttcgacgtccagcagatcgatcagctgttccagcagcaatac
ggcaatatcgatctgagcgcgagcgaacagcagctggtcgccggtgcgcgtagccgctgg
cagaacacggtcggcggccttcaggacgccctgcgcgtgcaggccggcgtcgtcggcaat
atcgagaccaaccgcgcgcagatgtccgcgctgatcggacagagccagggggcgaccgga
gcacttcagacagcccaggccggcaaccagctcctcgcgctccaggcgcagcagctttcc
gacctcaccgcagtcgtcgctgccaatggccgggcgatcgccttgagtgaagcggaacga
acggccgcggccgaacaaggccgcatccaacgccagcgcttcctgtcgccgggctccggc
taccagcccggcaacgcgcgcatgttcaataactga

DBGET integrated database retrieval system