Lactobacillus acidophilus NCFM: LBA0639 Help Entry LBA0639           CDS       T00231                                  Symbol ptsH Name (GenBank) phosphocarrier protein HPr   KO K02784   phosphocarrier protein HPr Organism lac  Lactobacillus acidophilus NCFM Pathway lac02060   Phosphotransferase system (PTS) Brite KEGG Orthology (KO) [BR:lac00001]  09130 Environmental Information Processing   09131 Membrane transport    02060 Phosphotransferase system (PTS)     LBA0639 (ptsH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:lac02000]     LBA0639 (ptsH) Transporters [BR:lac02000]  Phosphotransferase system (PTS)   Enzyme I and HPr    Phosphocarrier protein HPr [TC:8.A.8]     LBA0639 (ptsH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PTS-HPr Motif Other DBs NCBI-ProteinID:  AAV42518 UniProt:  Q5FLA6 LinkDB All DBs Position 626544..626810 Genome browser AA seq 88 aa AA seqDB search MEKRDFHIIAETGIHARPATLLVQAASKFGSDINLEYNGKSVNLKSIMGVMSLGVGQNAD VTITAEGDDEKDALDAIADTMKKEGLAE NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggaaaaacgtgattttcatattattgcagaaacaggtattcatgcacgtccagctact cttttagtacaagctgcttcaaagtttggttcagacattaacttggaatacaatggtaag tcagtaaacttaaagtcaatcatgggtgttatgtcacttggtgttggtcaaaacgctgac gttactatcactgctgaaggtgacgacgaaaaagacgcattagacgcaattgcagacact atgaaaaaagaaggtttagctgaataa

DBGET integrated database retrieval system