KEGG   Ligilactobacillus acidipiscis: LAC1533_1345
Entry
LAC1533_1345      CDS       T05349                                 
Name
(GenBank) Phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
laca  Ligilactobacillus acidipiscis
Pathway
laca00770  Pantothenate and CoA biosynthesis
laca01100  Metabolic pathways
laca01240  Biosynthesis of cofactors
Module
laca_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:laca00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    LAC1533_1345
Enzymes [BR:laca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     LAC1533_1345
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig SNAD2
Other DBs
NCBI-ProteinID: SFV40765
UniProt: A0A1K1KPL3
LinkDB
Position
I:complement(1470848..1471330)
AA seq 160 aa
MIALFPGSFDPLTNGHLDLIFRASKMYDKIIVAIMTNTSKKPLFSSDEKLRLIQEDVAEI
DNVEVVAVESDLTVNVMRRLNASILVRGVRDVKDFEYEREIAAMNSRLDPEIETVLLLAR
PEYSFLSSSMIKEVGQFNGNISQFVPANVAKSLQKKWAHE
NT seq 483 nt   +upstreamnt  +downstreamnt
atgatagctttgtttcctggaagttttgatcctttaaccaatggtcatttagatttaatt
ttcagagcttctaaaatgtacgataagatcattgttgctatcatgacaaatacctcgaag
aaacctttgttttcatcagacgaaaagctgcgtttgattcaagaggatgttgctgagata
gataacgttgaagtcgttgctgtggaatcagacttgactgttaacgttatgcgtcgttta
aatgcttctattttggttcgtggtgtgcgtgatgttaaggattttgaatacgaacgtgag
attgctgcaatgaatagtcgcttggatccagagatagaaacagtcttattgttggctcga
cctgaatattcgtttttgtcatcgagtatgatcaaagaagtcggtcaatttaatgggaac
atttctcaatttgttccggctaatgttgctaagtctcttcaaaaaaagtgggctcatgaa
taa

DBGET integrated database retrieval system