Luteibacter aegosomatis: L2Y94_17725 Help Entry L2Y94_17725       CDS       T09054                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism laeg  Luteibacter aegosomatis Brite KEGG Orthology (KO) [BR:laeg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:laeg03036]     L2Y94_17725 (ftsL) Chromosome and associated proteins [BR:laeg03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     L2Y94_17725 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC DUF6234 Motif Other DBs NCBI-ProteinID:  UPG85129 LinkDB All DBs Position complement(3937812..3938084) Genome browser AA seq 90 aa AA seqDB search MKAFGALCLTILLLAVIASAIGVVWTRHESRVLFVELSRLQSQKDDLGVEYGRLELEQAT YAEPSRIDAEARARLGMFTPKQQDIQLVRR NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaagccttcggcgccctctgcctcacgatcctgctgctggcggtcatcgccagcgcg atcggcgtggtgtggacgcgccacgaaagccgggtgctcttcgtggaactgtcgcgcctg caaagccagaaggacgacctcggcgtcgaatacggccgcctcgaactggagcaggccacc tatgcggagcccagccgcatcgatgcggaagcccgcgcgcgcctcggcatgttcacgccg aagcagcaggacatccagctggtgcgccgatga

DBGET integrated database retrieval system