KEGG   Roseibium algicola: B0E33_14665
Entry
B0E33_14665       CDS       T04723                                 
Name
(GenBank) fructose reductase
  KO
K19181  1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming) [EC:1.1.1.292]
Organism
lagg  Roseibium algicola
Brite
KEGG Orthology (KO) [BR:lagg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B0E33_14665
Enzymes [BR:lagg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.292  1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming)
     B0E33_14665
SSDB
Motif
Pfam: GFO_IDH_MocA GFO_IDH_MocA_C3 GFO_IDH_MocA_C NAD_binding_3 GcnA_N Gal80p_C-like
Other DBs
NCBI-ProteinID: AQQ04663
UniProt: A0ABM6I2R8
LinkDB
Position
3115899..3116897
AA seq 332 aa
MRWALIGASRIASSYMIDAIRSQNADIQSVLSSDAARGEAYAREHGIADSFTDLDALLAD
DSVDAVYISTTNEKHHAQALAAIAAGKHVLCEKPLAMNLDEAGEMVRTAAGKGVVFATNH
HLRNAGSHLAIRELIASGRIGKVLSARVFHAVNLPDALRGWRINDASAGGGVIPDITVHD
ADTIRFHLGEDPQEVVAKAAASGLGEGVEDSVMSVWSMPSGAMVQSHESFTHKFAGTGIE
FHGTDGSIFARNVMTQEPVGAVRLVDADGEHEISYDKHNLYHRALGLFADAVNGKGRPSA
DGVDGVKSLAVALAVREAAQSGKAVAVNYGGF
NT seq 999 nt   +upstreamnt  +downstreamnt
atgcgttgggcccttatcggtgcaagccgaattgcgtcgagttatatgatcgatgcgata
cgctcgcagaatgccgacatccagtccgtcctgagttcggatgcggcccgcggcgaggcg
tatgcccgtgagcatggtattgccgacagcttcacggatctggatgcgctccttgcggat
gacagtgtcgacgcggtctatatttccaccaccaacgaaaagcaccatgcgcaggcgctg
gccgcgatcgctgccggaaagcatgtgctgtgcgaaaaaccgctggccatgaacctggat
gaggccggtgaaatggttcgcactgccgccggcaagggtgtggtctttgcgaccaatcat
catttgcgcaatgccgggtctcatctggccatccgcgagctgatcgcttccggccgcatc
ggcaaggtgttgagcgcacgcgtcttccatgcggtcaacctgccggacgcgttgcgcggc
tggcgcatcaacgatgcgtccgccggtggcggcgtcattcccgatatcaccgtgcatgac
gcggacaccatccgcttccacctgggtgaagacccgcaggaagtcgttgccaaggcagca
gcctcaggcctcggagaaggggtcgaggacagcgtgatgtccgtctggtcgatgccgtcg
ggtgccatggtgcagtcgcatgaaagcttcacgcataaatttgcgggaaccggcatcgag
tttcacggcacggatgggtcgatcttcgcccgcaacgtcatgacccaggaacctgtcgga
gcggttcgtctggtcgatgcggatggcgaacacgagatctcctacgacaagcataacctc
taccaccgcgcgctcggcctctttgccgatgcggtcaacggcaaggggcgtccttctgcc
gatggtgtcgacggggtcaagtcgctggcggtcgcccttgccgtgcgcgaggccgcgcag
tccggcaaggctgttgccgtcaattacggaggcttctga

DBGET integrated database retrieval system