Roseibium algicola: B0E33_28405
Help
Entry
B0E33_28405 CDS
T04723
Name
(GenBank) thiol reductant ABC exporter subunit CydD
KO
K16013
ATP-binding cassette, subfamily C, bacterial CydD
Organism
lagg
Roseibium algicola
Pathway
lagg02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
lagg00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
B0E33_28405
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
lagg02000
]
B0E33_28405
Transporters [BR:
lagg02000
]
ABC transporters, eukaryotic type
ABCC (CFTR/MRP) subfamily
ABCC-BAC subgroup
B0E33_28405
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
ABC_membrane
AAA_29
AAA_16
AAA_30
AAA_22
T2SSE
cobW
AAA_23
AAA_7
Motif
Other DBs
NCBI-ProteinID:
AQQ07018
UniProt:
A0ABM6I967
LinkDB
All DBs
Position
complement(6143661..6145469)
Genome browser
AA seq
602 aa
AA seq
DB search
MTIKREKIGTVAEGEGQDSGAAAAFGWPDKGESRSLKRAGRLLAVSDLLWIAQAGLISWA
LGSLPMMFSVADDGQVIEGDLTGLAFQAAAGIALVAVLRVFLQNRAETVARQTARAIQSR
ARAELLSVAARTSPSAEFPSSGAFAAHVTEQVDLLGPYYRNFEPQKVRLRLVPLGIVAAT
AVFSWVGALILVVCGPLIPVFMALIGMRAKAASETQQEELVRLSGSLLDRIRGLETLTLF
GAIERTQRQIADAGERFRSGTMRVLKIAFLSSTVLELFSALGIAFCAVYVGFSLLGEIQA
GTWGGPLTFAQGLFILLLAPEFFAPLRAYAAAYHDRAGGLAARKKLATLFPSQNTPGNPK
RADGSDVPVGSISLSGPPAIQFRSVSITHDERCVFKEFNLTIEPDETLLVEGPSGSGKTT
MIDGILGFQEPDSGKIQVNDLTATAIASLLRRKVIWLGQSPRLFHGSLKANLLRAVDTSA
AVTEDDLWQALRLAGAEALVQRLPRGLETPLGEDGFGLSVGEIRRVALARAAMRKDAVLL
LADEPTASLDEETAADVIEGLRKLCDGRTAVIATHDPALRKIASRRIDLKALGVLAEGEV
FA
NT seq
1809 nt
NT seq
+upstream
nt +downstream
nt
atgacaataaaaagggaaaagatcgggacggtggctgagggtgaggggcaggacagcgga
gcagcagctgctttcggctggccggacaaaggagaaagccgcagcctgaaacgggctggt
cggctgctggccgtatccgatctgctgtggattgcacaggccggactgatttcctgggcg
ctcggatcgctccccatgatgttttccgtcgcggatgacggccaggtcatcgaaggcgat
ctgacaggcttggctttccaggctgccgccggcatcgcgctggttgctgtgttgagagtg
tttctgcaaaaccgagccgaaacggttgcccggcaaactgcccgtgcaatccagagcagg
gcacgtgcagagctgctttccgttgccgccagaacgtcgccatctgcagaattcccatct
tccggtgcctttgccgcccatgttaccgaacaggtcgacctgctcggaccgtactatcgg
aatttcgaacctcagaaggttcggcttcgtcttgtgcccctcgggatcgttgccgccact
gccgtgttcagttgggtcggcgcgctgatcctggttgtctgcgggccgctcattcctgtt
ttcatggcgctgattggtatgcgtgccaaggctgcgagcgagacgcaacaggaggaactg
gtgcggctgagcggcagtctgctggacaggatcaggggcctggaaacactgaccttgttt
ggcgcaatcgagcgtacccagcggcaaatcgctgacgcgggcgaacggttcagatccggc
accatgcgcgtcctgaagatcgcattcctctcctcaaccgttctggaactcttttccgca
ctcggaatagccttctgcgcggtctatgtggggttttcgctattgggtgaaatccaggct
ggaacctggggcgggcccctgacctttgcgcagggcctgttcattctgctgctcgcaccg
gagttctttgcccccttgcgtgcctacgcggcagcctatcatgacagggcaggcggactt
gccgcgcggaagaagctggcgacactttttccgtcgcagaacacccccggaaaccctaag
cgcgctgatggatcagacgtgccggtcggttccatttcactttcaggcccgcccgccatt
cagttcaggtctgtcagcattacccatgatgagcgctgtgtcttcaaggagttcaatctg
acgattgagccggatgaaacgcttttggtcgaagggccgagcggcagcggcaagaccaca
atgattgacgggatactgggcttccaggagcctgattccggcaaaattcaggtgaacgac
cttactgcaaccgcgattgcatcattgctgcgtcgaaaggttatatggctcggccagtcg
cccaggctgttccatggcagtctcaaggccaacctcctgagagctgttgatacatctgca
gcggttacggaggacgatctctggcaagcccttcgccttgccggggccgaagcgctcgtc
cagcgcctgcctcgtggtctggaaacacctttgggagaagacggtttcggcctctcggtt
ggggagatccgccgggtggctctcgcgagggcggcaatgcgcaaggatgctgtcctgctg
ctggcggacgaaccaacagcctcgctggatgaagaaacggcagcagatgtcatcgaggga
ttgcggaaactttgcgatggccggaccgccgtgatcgccacacacgacccggcccttcgg
aaaatcgcctcgcggcggattgacctgaaggcgctcggcgtcctcgccgaaggggaggtg
ttcgcgtga
DBGET
integrated database retrieval system