Lingula anatina: 106152472 Help Entry 106152472         CDS       T04921                                  Name (RefSeq) calmodulin-like isoform X1   KO K02183   calmodulin Organism lak  Lingula anatina Pathway lak04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:lak00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     106152472  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:lak01009]     106152472   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lak04131]     106152472    03036 Chromosome and associated proteins [BR:lak03036]     106152472   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lak04147]     106152472 Protein phosphatases and associated proteins [BR:lak01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      106152472 Membrane trafficking [BR:lak04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     106152472 Chromosome and associated proteins [BR:lak03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      106152472 Exosome [BR:lak04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    106152472 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_9 EH EF_EFCAB10_C Dockerin_1 SPARC_Ca_bdg Caleosin Motif Other DBs NCBI-GeneID:  106152472 NCBI-ProteinID:  XP_013381518 UniProt:  A0A1S3H8R3 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MAAQLTDEQIAEFKEAFSLFDKNGDGTITTKELGTVMRSLGLNPTEAELVDMIKEVDADG NGTIDLPEFLTMMAKKMDD NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggcagcccaactcacagacgaacagattgctgaattcaaagaggcattctccctgttt gacaagaatggggatgggaccatcacaaccaaggagttgggcactgtgatgaggtcgctt ggactgaaccctacagaggctgaacttgtggatatgatcaaagaagtggatgctgatggt aatgggacaattgatttaccagagttcttgaccatgatggctaagaaaatggatgactga

DBGET integrated database retrieval system