Lingula anatina: 106177716 Help Entry 106177716         CDS       T04921                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism lak  Lingula anatina Brite KEGG Orthology (KO) [BR:lak00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lak03036]     106177716   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lak04147]     106177716 Chromosome and associated proteins [BR:lak03036]  Eukaryotic type   Nucleosome assembly factors    Histones     106177716 Exosome [BR:lak04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106177716 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  106177716 NCBI-ProteinID:  XP_013416026 UniProt:  A0A1S3K175 LinkDB All DBs Position Unknown AA seq 84 aa AA seqDB search MAYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCA IHAKRVTIMPKDIQLARRIRGERA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcttaccagaagagcacagagcttctgatccgcaagctccccttccagcgtctggtc cgtgaaatcgcccaggacttcaaaactgacctgagattccagagctctgcggttatggcc ctgcaggaagctagcgaggcttacttggttggtcttttcgaggacaccaacctgtgcgcc atccacgccaagcgtgtgaccatcatgcccaaggatatccagctggctcgccgtatccgc ggagagcgtgcttaa

DBGET integrated database retrieval system