Lacimicrobium alkaliphilum: AT746_19320 Help Entry AT746_19320       CDS       T04189                                  Name (GenBank) hypothetical protein   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism lal  Lacimicrobium alkaliphilum Pathway lal00290   Valine, leucine and isoleucine biosynthesis lal00650   Butanoate metabolism lal00660   C5-Branched dibasic acid metabolism lal00770   Pantothenate and CoA biosynthesis lal01100   Metabolic pathways lal01110   Biosynthesis of secondary metabolites lal01210   2-Oxocarboxylic acid metabolism lal01230   Biosynthesis of amino acids Module lal_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine lal_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:lal00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     AT746_19320    00660 C5-Branched dibasic acid metabolism     AT746_19320   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     AT746_19320   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     AT746_19320 Enzymes [BR:lal01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      AT746_19320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  ALT00204 UniProt:  A0A0U2QQV0 LinkDB All DBs Position 4317685..4317927 Genome browser AA seq 80 aa AA seqDB search MTYDLELLLSDQPAALERVLQTARYRGFKVRQLQMHQRGSGLQLSMQVSGPQPINILTTQ LHKLYDLASLNIEQTLPQTA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacctacgacctggaattactcttatctgatcagcctgctgcgttagagcgggtgtta caaactgctcgctaccgtggctttaaagtccgccagttgcagatgcaccagcgtggttca ggtttacagttgtcgatgcaggtatccggcccacaacccattaacatactgacgacccag ctacataagttgtatgatctggcctcactgaatattgagcaaacattgccgcaaacggca taa

DBGET integrated database retrieval system